| Clone Name | rbastl44f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSR1_ASHGO (Q757H2) Phosphatidylinositol transfer protein CSR1 | 28 | 8.3 | 2 | ADA12_MOUSE (Q61824) ADAM 12 precursor (EC 3.4.24.-) (A disinteg... | 28 | 8.3 | 3 | ADA12_HUMAN (O43184) ADAM 12 precursor (EC 3.4.24.-) (A disinteg... | 28 | 8.3 |
|---|
>CSR1_ASHGO (Q757H2) Phosphatidylinositol transfer protein CSR1| Length = 436 Score = 28.1 bits (61), Expect = 8.3 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 14 LPSLFGMEPPEFQG---VHTSYMLSVGIWLLVKN*VDSVVTQTLECTRCITDMDSLCPEI 184 L + F PE G +H + + IW ++KN +D VV + T+ D++ P Sbjct: 274 LITCFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVAAKIAFTKTAADLEEFIPAE 333 Query: 185 ATP 193 P Sbjct: 334 QIP 336
>ADA12_MOUSE (Q61824) ADAM 12 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 12) (Meltrin alpha) Length = 903 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 190 CRNFWTKGIHVCNTPCTF*GLCDNRIN 110 C+N G+H C C G+C+NR N Sbjct: 647 CQNISVFGVHKCAMQCHGRGVCNNRKN 673
>ADA12_HUMAN (O43184) ADAM 12 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 12) (Meltrin alpha) Length = 909 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 190 CRNFWTKGIHVCNTPCTF*GLCDNRIN 110 C+N G+H C C G+C+NR N Sbjct: 649 CQNISVFGVHECAMQCHGRGVCNNRKN 675 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,495,273 Number of Sequences: 219361 Number of extensions: 1175067 Number of successful extensions: 2487 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2487 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)