Clone Name | rbastl44f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HTPG_BACHD (Q9KE51) Chaperone protein htpG (Heat shock protein h... | 28 | 5.7 | 2 | SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (... | 28 | 7.4 | 3 | SALL3_HUMAN (Q9BXA9) Sal-like protein 3 (Zinc finger protein SAL... | 27 | 9.7 | 4 | PYRG_CAUCR (Q9A7K3) CTP synthase (EC 6.3.4.2) (UTP--ammonia liga... | 27 | 9.7 |
---|
>HTPG_BACHD (Q9KE51) Chaperone protein htpG (Heat shock protein htpG) (High| temperature protein G) Length = 625 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 325 NSTAALRNGNPSDEQHDVILEVAWVLYSAGLIAPMFTVTCK 203 + + A + N S + HD+I + YSA ++A TVT K Sbjct: 97 SGSLAFKTENESKDGHDIIGQFGVGFYSAFMVADKVTVTTK 137
>SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (MSal)| (Fragment) Length = 1323 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 180 QLPVTKPTLHVTVNMGAISPAEYSTQATSKITSCCSSL 293 QLP T P H + +I+P S Q S +S C+SL Sbjct: 507 QLPPTVPGTHNYTDSPSITPVSRSPQRPSPASSECTSL 544
>SALL3_HUMAN (Q9BXA9) Sal-like protein 3 (Zinc finger protein SALL3) (hSALL3)| Length = 1300 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 180 QLPVTKPTLHVTVNMGAISPAEYSTQATSKITSCCSSL 293 QLP T P H + + +PA S Q S +S C+SL Sbjct: 529 QLPPTVPGAHGYADSPSATPASRSPQRPSPASSECASL 566
>PYRG_CAUCR (Q9A7K3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 550 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 4 WRHGVGYHPRAQVLPFADPDLFAN 75 W GV YHP + PFA LFA+ Sbjct: 515 WFIGVQYHPELKSRPFAPHPLFAS 538 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,507,655 Number of Sequences: 219361 Number of extensions: 790751 Number of successful extensions: 2067 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2067 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)