| Clone Name | rbastl44f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocy... | 103 | 3e-22 | 2 | Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA int... | 33 | 0.40 | 3 | ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit... | 30 | 3.4 | 4 | SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6... | 29 | 5.8 | 5 | WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4) | 28 | 9.9 |
|---|
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 103 bits (256), Expect = 3e-22 Identities = 48/77 (62%), Positives = 61/77 (79%) Frame = -2 Query: 484 ALAAIPSIDSEAVQQRLDRVRTFYELLNLPFETLLGFIAEQEYLFSAKEYLSILKVNVPG 305 A+AAIP ID E VQQ LDRVRT++ELLN+PFE LL FIAE + +F+ EY ++LKVNVPG Sbjct: 977 AMAAIPYIDGETVQQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPG 1036 Query: 304 REIPMDAERRISQILGH 254 R+ P DA+ R+ +IL H Sbjct: 1037 RDTPSDAQSRLLEILSH 1053
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.40 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 17 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 190 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 232 Score = 30.0 bits (66), Expect = 3.4 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -2 Query: 436 LDRVRTFYELLNLP-FETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPM 290 L R RT E + L F T+ I+ ++L+ ++ SIL +N PG +P+ Sbjct: 119 LHRARTVGESIILSVFSTVRSLISTIKHLYELPQFPSILLLNGPGTSVPL 168
>SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)| (Isoleucine--tRNA ligase) (IleRS) Length = 1064 Score = 29.3 bits (64), Expect = 5.8 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -2 Query: 463 IDSEAVQQRLDRVRTFYEL-----------LNLPFETLLGFIAEQEYLFSAK 341 +D E V +R+ R++T EL L P +TL+ + +EYL AK Sbjct: 808 LDDETVLRRVKRMQTIIELARYVREQNNISLKTPLKTLIVILTNEEYLEDAK 859
>WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4)| Length = 539 Score = 28.5 bits (62), Expect = 9.9 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 35 TFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGRYC 202 T R K +I+ N SMRQ + + ++KKP ++ Y E+ YC Sbjct: 423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,424,572 Number of Sequences: 219361 Number of extensions: 1003688 Number of successful extensions: 2469 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2467 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)