Clone Name | rbastl44e08 |
---|---|
Clone Library Name | barley_pub |
>GUNA_PSEFL (P10476) Endoglucanase A precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) (EGA) Length = 962 Score = 30.8 bits (68), Expect = 0.87 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 17 MATSHLNLQLASNVLHPLSLTRLLDLYSWINGKIRKNKL*IGALAYAFTG 166 +A++HL Q AS PLS Y W + + NKL + LAY F+G Sbjct: 440 IASTHLTTQSASGYPAPLSSLE----YYWGSNSVIANKLVLMGLAYDFSG 485
>CCNL2_RAT (Q5I0H5) Cyclin-L2| Length = 520 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 211 SKRSDVNGSWQPANLPCKCI--SKRTNLELVLPNFP 110 S R+DV +QP ++ C CI + RT LE+ LPN P Sbjct: 224 SLRTDVFVRFQPESIACACIYLAART-LEIPLPNRP 258
>CCNL2_HUMAN (Q96S94) Cyclin-L2 (Paneth cell-enhanced expression protein)| Length = 520 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 211 SKRSDVNGSWQPANLPCKCI--SKRTNLELVLPNFP 110 S R+DV +QP ++ C CI + RT LE+ LPN P Sbjct: 226 SLRTDVFVRFQPESIACACIYLAART-LEIPLPNRP 260
>CCNL2_MOUSE (Q9JJA7) Cyclin-L2 (Cyclin Ania-6b) (Paneth cell-enhanced| expression protein) (PCEE) Length = 518 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 211 SKRSDVNGSWQPANLPCKCI--SKRTNLELVLPNFP 110 S R+DV +QP ++ C CI + RT LE+ LPN P Sbjct: 224 SLRTDVFVRFQPESIACACIYLAART-LEIPLPNRP 258
>CCNL1_CHICK (Q5ZJP9) Cyclin-L1| Length = 534 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 211 SKRSDVNGSWQPANLPCKCI--SKRTNLELVLPNFP 110 S R+DV +QP ++ C CI + RT LE+ LPN P Sbjct: 237 SLRTDVFVRFQPESIACACIYLAART-LEIPLPNRP 271
>YIZI_SCHPO (Q9US42) Hypothetical protein C1002.18 in chromosome I| Length = 399 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 32 LNLQLASNVLHPLSLTRLLDLYSWINGKIRKNKL 133 +N +L + PLSL ++L+ SW +G+I KL Sbjct: 348 VNERLKPELSEPLSLAQMLEAGSWKSGRIIAKKL 381
>RPP8_ARATH (Q8W4J9) Disease resistance protein RPP8 (Resistance to Peronospora| parasitica protein 8) Length = 908 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 47 ASNVLHPLSLTRLLDLYSWINGKIRKNKL*IGALAY-----AFTGQISRLPRTI 193 +++V H L+L R+LDL SW+ + K IG L + + ++S LP T+ Sbjct: 568 SASVFHNLTLLRVLDL-SWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTM 620
>PUR2_CHICK (P21872) Trifunctional purine biosynthetic protein adenosine-3| [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidin Length = 1003 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 53 NVLHPLSLTRLLDLYSWINGKIRKNKL*IGAL 148 N+L L R L ++S I GKI+ NK+ + L Sbjct: 778 NLLQALQANRSLSVHSHIQGKIQTNKVKVAVL 809
>ZBT7B_MOUSE (Q64321) Zinc finger and BTB domain-containing protein 7B (Zinc| finger protein 67) (Zfp-67) (Zinc finger protein Th-POK) (T-helper-inducing POZ/Kruppel-like factor) (Kruppel-related zinc finger protein cKrox) (c-Krox) Length = 544 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 232 RKRRKSAKENASPHFPNSSTPSFFQALINLATKHM 336 R RR+ + A+PH+P ST + A ++L+ H+ Sbjct: 462 RTRRRRKDDVAAPHYPPPSTTTSSPAGLDLSNGHL 496
>CATD_PIG (P00795) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 345 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 13 LHGYFASQSTISIQCSASVIADSAVGPIFVDQ 108 L GY +SQ T+S+ C++++ S VG I V++ Sbjct: 83 LSGYLSSQDTVSVPCNSAL---SGVGGIKVER 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,181,218 Number of Sequences: 219361 Number of extensions: 713560 Number of successful extensions: 1559 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1559 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)