Clone Name | rbastl44e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YSYF_CAEEL (Q8TA81) Hypothetical F-box protein ZK328.6 | 28 | 5.9 | 2 | ACHG_CHICK (P02713) Acetylcholine receptor protein, gamma subuni... | 28 | 7.7 |
---|
>YSYF_CAEEL (Q8TA81) Hypothetical F-box protein ZK328.6| Length = 394 Score = 28.1 bits (61), Expect = 5.9 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +3 Query: 18 FISGATRLSYNITITFKFKAVRLET-KN*VKWINNT-TEGSH--SHRPDETTKILETKLE 185 F G T +SYN TF+ + +ET N VK I T ++G+H P + K++ K E Sbjct: 257 FADGTTPVSYNPLDTFRISSCSIETVDNLVKSIQMTASQGTHVDGVPPTKKKKVIRKKKE 316
>ACHG_CHICK (P02713) Acetylcholine receptor protein, gamma subunit precursor| Length = 514 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +1 Query: 196 GG*HYLP---HRHSYSPNISYFPFTWSLPTQT*KGTTY 300 G ++LP +R S S +++YFPF W T + TY Sbjct: 136 GSIYWLPPAIYRSSCSIHVTYFPFDWQNCTMVFQSQTY 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,628,013 Number of Sequences: 219361 Number of extensions: 996866 Number of successful extensions: 2517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2517 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)