Clone Name | rbastl44c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GPI16_SCHPO (O94380) GPI transamidase component PIG-T homolog pr... | 29 | 2.3 | 2 | VGLX_EHV1K (P32514) Glycoprotein GX precursor | 28 | 4.0 | 3 | VGLG_EHV1V (P84393) Glycoprotein G precursor | 28 | 4.0 | 4 | VGLG_EHV1B (P28967) Glycoprotein G precursor | 28 | 4.0 | 5 | VGLG_EHV4 (P32650) Glycoprotein G precursor | 27 | 8.8 | 6 | STAT1_CAEEL (Q9NAD6) Signal transducer and activator of transcri... | 27 | 8.8 |
---|
>GPI16_SCHPO (O94380) GPI transamidase component PIG-T homolog precursor| Length = 545 Score = 29.3 bits (64), Expect = 2.3 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 42 DSTSNYQVPKLFPRVWSAVK*VATTRVQFFLSLTNYFLQTLNFQPLFQLYPSK 200 DS++ YQ +P +S + Q+F SL + T N PLF+L P K Sbjct: 149 DSSNTYQPQLSYPGSFSF-----SNNTQYFASLPQEDVCTENLSPLFKLLPCK 196
>VGLX_EHV1K (P32514) Glycoprotein GX precursor| Length = 411 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 296 DGQTHSG-SFNGMEECLEDLLVGYVCVALI 382 D TH+G + NG+++C L Y C+ALI Sbjct: 338 DDSTHTGGASNGIQDCDSQLKTVYACLALI 367
>VGLG_EHV1V (P84393) Glycoprotein G precursor| Length = 411 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 296 DGQTHSG-SFNGMEECLEDLLVGYVCVALI 382 D TH+G + NG+++C L Y C+ALI Sbjct: 338 DDSTHTGGASNGIQDCDSQLKTVYACLALI 367
>VGLG_EHV1B (P28967) Glycoprotein G precursor| Length = 411 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 296 DGQTHSG-SFNGMEECLEDLLVGYVCVALI 382 D TH+G + NG+++C L Y C+ALI Sbjct: 338 DDSTHTGGASNGIQDCDSQLKTVYACLALI 367
>VGLG_EHV4 (P32650) Glycoprotein G precursor| Length = 405 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 296 DGQTHSGSFNGMEECLEDLLVGYVCVALI 382 D T G +G+++C L Y+C+ALI Sbjct: 371 DSITTGGVLHGLQDCDNQLKTVYICLALI 399
>STAT1_CAEEL (Q9NAD6) Signal transducer and activator of transcription 1| Length = 706 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 255 VLHITSTSNFSALSTARLIQEASTAWKNAWRIYSLAM 365 V+ + +NF+ + +LI E +WKNA ++ + M Sbjct: 89 VIKLNDGTNFATMLQTQLIGEKLFSWKNAQKLAQIGM 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,721,519 Number of Sequences: 219361 Number of extensions: 887920 Number of successful extensions: 1919 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1919 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)