Clone Name | rbastl44c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DC12_XENTR (Q6P7N4) UPF0361 protein DC12 homolog | 30 | 2.8 | 2 | MTSS1_MOUSE (Q8R1S4) Metastasis suppressor protein 1 (Missing in... | 29 | 4.7 | 3 | PPNK1_PROMP (Q7V3C2) Probable inorganic polyphosphate/ATP-NAD ki... | 29 | 4.7 | 4 | SIF2_YEAST (P38262) SIR4-interacting protein SIF2 | 29 | 6.2 | 5 | YMR7_YEAST (Q04371) Protein YMR027W | 28 | 8.1 | 6 | RABX5_HUMAN (Q9UJ41) Rab5 GDP/GTP exchange factor (Rabaptin 5-as... | 28 | 8.1 |
---|
>DC12_XENTR (Q6P7N4) UPF0361 protein DC12 homolog| Length = 335 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = -2 Query: 167 VRSDCSF-----ARAVPLWKDGTCRDYQSSQQSLPCKMFPPNYSLSHYQ 36 VR C++ R P W+DG YQ S P P SL H+Q Sbjct: 14 VRKACTYRDKQGGRKWPNWRDGDSDKYQPSYNKSPQSNSPVLLSLKHFQ 62
>MTSS1_MOUSE (Q8R1S4) Metastasis suppressor protein 1 (Missing in metastasis| protein) Length = 759 Score = 29.3 bits (64), Expect = 4.7 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 228 ITQSLSIITISPPNHNLKVMIGPY*HFEIFERY-HQISSFSSPESPQFYTLNPFGRTSSG 404 ++ S ++S +H V GP+ H R +++S P+ +YT+ P SS Sbjct: 350 LSNGFSHCSLSSESHAGPVGAGPFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQ 409 Query: 405 VSSWRSAWAVLG 440 + SW+ WA G Sbjct: 410 IPSWKD-WAKPG 420
>PPNK1_PROMP (Q7V3C2) Probable inorganic polyphosphate/ATP-NAD kinase 1 (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase 1) Length = 299 Score = 29.3 bits (64), Expect = 4.7 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 7/42 (16%) Frame = -2 Query: 143 RAVPLWKDGT-C-----RDY-QSSQQSLPCKMFPPNYSLSHY 39 R + LWKDG+ C DY + ++ + PCKM N S+S+Y Sbjct: 237 REIKLWKDGSKCMTIKENDYCEINKVTKPCKMIKFNKSISYY 278
>SIF2_YEAST (P38262) SIR4-interacting protein SIF2| Length = 535 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 239 GLGDGYSCFLGTTLSVLG-SWIGS*VRSDCSFARAVPLW 126 G G+ +CF G + S++ SW+G CS +V LW Sbjct: 389 GNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLW 427
>YMR7_YEAST (Q04371) Protein YMR027W| Length = 470 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 23 IHSLIDNGTKNNLEGTFYKGEIADWT--GNPCKFHPSTVELPLQSYNLI*LRTQSNYPRL 196 + + +G E +F+ E+ W N K+H S + LQ NL+ + NY +L Sbjct: 331 MEKFVSSGKIEFREDSFWTTELDYWNLDANETKYHGSILHKDLQKSNLVIFKGDLNYRKL 390
>RABX5_HUMAN (Q9UJ41) Rab5 GDP/GTP exchange factor (Rabaptin 5-associated| exchange factor for Rab5) (Rabex-5) Length = 708 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 128 WKDGTCRDYQSSQQSLPCKMFPPNYSLSHYQSMN 27 W DG R+ Q + P ++ PPN L+ S N Sbjct: 658 WTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSEN 691 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,666,383 Number of Sequences: 219361 Number of extensions: 1446327 Number of successful extensions: 3673 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3673 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)