Clone Name | rbastl44b10 |
---|---|
Clone Library Name | barley_pub |
>SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1043 Score = 34.3 bits (77), Expect = 0.078 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -1 Query: 331 EVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPSLAQT-VQQLLLQEF*AAPLY 155 E F T VKP+F +SL R R+ + D K+ SL+Q +QQLL QE+ + L Sbjct: 862 EAPSFVKTTVKPNF-----RSLGR-RVGEKIKDIQKALASLSQAQIQQLLTQEYLSLNLG 915 Query: 154 EEEIMCH 134 EEI+ H Sbjct: 916 SEEIVLH 922
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 34.3 bits (77), Expect = 0.078 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 349 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARW 239 S +K E+ +FFAT+ F+++L QSL+ + A+W Sbjct: 807 SMQKIDEIKKFFATKSTKGFDQSLAQSLDTITSKAQW 843
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -1 Query: 331 EVSQFFATRVKPSFERALKQSLERVRISARWID 233 ++ +FFA + +ERAL+QSL+ + ++ +ID Sbjct: 834 KIKEFFADKDTKLYERALQQSLDTISANSSFID 866
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 349 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 212 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 349 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 212 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 349 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 212 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsATF573)| (NADH:oxygen oxidoreductase) Length = 573 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 215 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELG 325 G+ +D VD SSADP ++ L+ HASG LG Sbjct: 291 GVGVDMVDLSSADPQEIQELVG-------HASGVVLG 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,049,077 Number of Sequences: 219361 Number of extensions: 625264 Number of successful extensions: 1541 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1541 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)