>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein|
          Length = 312

 Score = 31.6 bits (70), Expect = 0.53
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 125 HRDGRKENQSVMWLKPPLSLQSLMQLMTCQSIRHDQPQDHVNTDEALLQRK*TDTS 292
           HR G+ +N+ V WL+    L     L+   ++   + Q  +  +EA  Q + T+TS
Sbjct: 80  HRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETS 135

>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3|
          Length = 1053

 Score = 28.1 bits (61), Expect = 5.9
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = -2

Query: 306  DVDIPLVSVYFR 271
            DVDIPLVSVYFR
Sbjct: 1042 DVDIPLVSVYFR 1053

>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2|
          Length = 1051

 Score = 28.1 bits (61), Expect = 5.9
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = -2

Query: 306  DVDIPLVSVYFR 271
            DVDIPLVSVYFR
Sbjct: 1040 DVDIPLVSVYFR 1051

>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1|
          Length = 1051

 Score = 28.1 bits (61), Expect = 5.9
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = -2

Query: 306  DVDIPLVSVYFR 271
            DVDIPLVSVYFR
Sbjct: 1040 DVDIPLVSVYFR 1051


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,948,038
Number of Sequences: 219361
Number of extensions: 802217
Number of successful extensions: 1461
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1447
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1461
length of database: 80,573,946
effective HSP length: 77
effective length of database: 63,683,149
effective search space used: 1528395576
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)