| Clone Name | rbastl44b02 |
|---|---|
| Clone Library Name | barley_pub |
>CSE1_ARATH (Q9ZPY7) Importin-alpha re-exporter (Cellular apoptosis| susceptibility protein homolog) Length = 972 Score = 36.2 bits (82), Expect = 0.034 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -2 Query: 429 PGRFGPTIEQHVDPANKNALLQLCAAYNANI 337 PGR+ I ++++ AN+ AL+QLC AYN I Sbjct: 941 PGRYPQIIGENLEQANQTALIQLCNAYNCGI 971
>BPAEB_MOUSE (Q60824) Bullous pemphigoid antigen 1, isoforms 6/7 (BPA)| (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) (Fragments) Length = 1678 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 210 SLHMDEPETSFMDT*HQETHHPLTKNPGNQANALERRRLAPRQCWHYRQHKAE 368 S D S DT +E HHP +PGN + + RL P W H+ E Sbjct: 900 STTQDHTFASAFDTAGRECHHPAEISPGNSGHLNLKTRL-PLSRWTQEPHQTE 951
>BPAEA_MOUSE (Q91ZU8) Bullous pemphigoid antigen 1, isoform 5 (BPA)| (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) Length = 2611 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 210 SLHMDEPETSFMDT*HQETHHPLTKNPGNQANALERRRLAPRQCWHYRQHKAE 368 S D S DT +E HHP +PGN + + RL P W H+ E Sbjct: 1833 STTQDHTFASAFDTAGRECHHPAEISPGNSGHLNLKTRL-PLSRWTQEPHQTE 1884
>GAG_AVISN (P03342) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30] (Fragment) Length = 313 Score = 30.4 bits (67), Expect = 1.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 214 YTWMNQKPASWTHDTKRLIIL*QKTLETKQMPWNDGVWLL 333 Y W NQ P+S++ ++I L + T Q W+D LL Sbjct: 226 YNWKNQNPSSFSQAPDQVISLLESVFYTHQPTWDDCQQLL 265
>GPC6A_RAT (Q70VB1) G-protein coupled receptor family C group 6 member A| precursor Length = 928 Score = 30.0 bits (66), Expect = 2.4 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 Query: 226 NQKPASWTHDTKRLIIL*QKTLETKQMPWNDGVWLLDNVGIIGSTKL 366 N A+WT+DT KT+ET ND +W G+I S +L Sbjct: 378 NYSQATWTYDTT-------KTIETHLFKRNDFLWHYTEPGLIHSIQL 417
>NU1M_PECMA (Q96186) NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (NADH| dehydrogenase subunit 1) Length = 354 Score = 29.6 bits (65), Expect = 3.2 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = -3 Query: 371 FFSFVLPIMPTLSRSQTPSFQGICLVSRVFCQRMMSLLVSC 249 FFSF++ + L RS P ++ L+ ++CQ ++ +L+SC Sbjct: 307 FFSFMVVFLIVLCRSSFPRYRYDMLMKLIWCQ-ILPILMSC 346
>TILS_ZYMMO (Q5NLX8) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 329 Score = 29.3 bits (64), Expect = 4.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 318 RRLAPRQCWHYRQHKAEEERFCLLGPHAAQW 410 RRL W RQH AE R+C A +W Sbjct: 209 RRLLKASPWINRQHIAEAARYCQQSEEAIEW 239
>COX1_CRION (P98003) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Fragment) Length = 340 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -3 Query: 128 GLEFCVRVEEFSFSQRVYWYWSSMLSTLSVCVVIP---GGV 15 G FC R + FSF + W S+++ L + + +P GGV Sbjct: 169 GTLFCCRRKFFSFLNWTLFIWGSLITALLLIITLPVLAGGV 209
>CI094_HUMAN (Q496M8) Protein C9orf94 precursor| Length = 467 Score = 28.5 bits (62), Expect = 7.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 336 QCWHYRQHKAEEERFCLLGPHAAQW 410 +C H R +KA E C GP A W Sbjct: 398 ECVHARTNKAVPEHLCSWGPRPANW 422
>FAS2_CANAL (P43098) Fatty acid synthase alpha subunit (EC 2.3.1.86) [Includes:| Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41) (Beta-ketoacyl synth Length = 1885 Score = 28.1 bits (61), Expect = 9.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 37 HTDNVDNMLDQYQYTLWEKENSST 108 + DNVD +L+QY+Y L+ + T Sbjct: 1614 NADNVDKLLEQYEYVLYPSRSIQT 1637
>DSBD_PASMU (Q9CP40) Thiol:disulfide interchange protein dsbD precursor (EC| 1.8.1.8) (Protein-disulfide reductase) (Disulfide reductase) Length = 576 Score = 28.1 bits (61), Expect = 9.2 Identities = 21/66 (31%), Positives = 27/66 (40%) Frame = -3 Query: 416 VLPLSSMWTQQTKTLFFSFVLPIMPTLSRSQTPSFQGICLVSRVFCQRMMSLLVSCVHEA 237 +LP S W Q K F FVL +P I L+SRVF + M L S Sbjct: 361 ILPKSGNWMIQVKNAF-GFVLLALP------------IFLISRVFPEIEMPLWFSLAFAF 407 Query: 236 GFWFIH 219 W ++ Sbjct: 408 SLWLLY 413
>TYDP1_HUMAN (Q9NUW8) Tyrosyl-DNA phosphodiesterase 1 (EC 3.1.4.-) (Tyr-DNA| phosphodiesterase 1) Length = 608 Score = 28.1 bits (61), Expect = 9.2 Identities = 15/69 (21%), Positives = 33/69 (47%) Frame = -1 Query: 265 VSWCHVSMKLVSGSSMCRLMVGWEEEGRQIKSYSRNMNFVEYLSILVWNFVCVWKSSLFP 86 +S C + + G+ ++M+ EEG ++ ++ N+ ++ +W S L+P Sbjct: 248 ISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQ----KTQGIWLSPLYP 303 Query: 85 RECTGTGRA 59 R GT ++ Sbjct: 304 RIADGTHKS 312 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,393,470 Number of Sequences: 219361 Number of extensions: 1513842 Number of successful extensions: 3870 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3868 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)