| Clone Name | rbastl44a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIR2_MYCPN (P75461) Ribonucleoside-diphosphate reductase beta su... | 28 | 5.7 | 2 | RIR2_MYCGA (Q9XC20) Ribonucleoside-diphosphate reductase beta su... | 28 | 7.4 | 3 | PRDM5_MOUSE (Q9CXE0) PR domain zinc finger protein 5 (PR domain-... | 28 | 7.4 | 4 | CCNT2_CAEEL (P34424) Cyclin-T1.2 | 28 | 7.4 | 5 | AAT_RICPR (Q9ZE56) Aspartate aminotransferase (EC 2.6.1.1) (Tran... | 27 | 9.7 |
|---|
>RIR2_MYCPN (P75461) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 339 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 183 EKLRTSPHLF-ETGALYSQNYDLLSPRYAGPGSSYCLNLSS*TTRICWEF 329 E+ R P +F + A +N+D S G GSSY + +S T W+F Sbjct: 294 EETRIKPEIFAQLSARADENHDFFS----GNGSSYVMGISEETEDKDWDF 339
>RIR2_MYCGA (Q9XC20) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 339 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 183 EKLRTSPHLF-ETGALYSQNYDLLSPRYAGPGSSYCLNLSS*TTRICWEF 329 E+ + SP +F + A +N+D S G GSSY + ++ T WEF Sbjct: 294 EETKISPEVFAQLSARADENHDFFS----GNGSSYIMGVTEETQDDDWEF 339
>PRDM5_MOUSE (Q9CXE0) PR domain zinc finger protein 5 (PR domain-containing| protein 5) Length = 599 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 79 NVTTGTTLLYL-CDCVNNRCTYVTALHEKKNFHQI 180 NV TG L C N +CT V++L E + H+I Sbjct: 254 NVHTGDPKRKLICSVCNRKCTSVSSLQEHRKIHEI 288
>CCNT2_CAEEL (P34424) Cyclin-T1.2| Length = 555 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 303 RNSSSGNMSYQVLHILGSANHSSENKVHQSRISVGLSA 190 RN + S LH +++ +S N HQ+R S GLSA Sbjct: 365 RNGHRPSSSSHPLHHHSTSSSASNNSNHQNRSSSGLSA 402
>AAT_RICPR (Q9ZE56) Aspartate aminotransferase (EC 2.6.1.1) (Transaminase A)| (ASPAT) Length = 399 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 43 PVTYWCDIVQFVNVTTGTTLLYLCDCVNNRCTYVTAL 153 PV YW V ++TGT + C NN V AL Sbjct: 121 PVPYWVSYPDMVALSTGTPVFVNCGIENNFKLSVEAL 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,390,723 Number of Sequences: 219361 Number of extensions: 889310 Number of successful extensions: 2027 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2027 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)