Clone Name | rbastl44a04 |
---|---|
Clone Library Name | barley_pub |
>GLMS_PYRKO (Q5JH71) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 601 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 278 RLATK*MDGCDVWTGDGRSVDVLDPSGRVGAGAERVGHLE 397 RL + D V TG+G ++DV +GR+ E++G LE Sbjct: 22 RLEYRGYDSAGVVTGNGETLDVRKGAGRIDKLTEKLGFLE 61
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 402 PASRCPTLSAPAPTLPDGSSTSTLRPSPVHTSHPSI 295 P PT P P LP STS+LR S T P + Sbjct: 317 PVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPV 352
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 402 PASRCPTLSAPAPTLPDGSSTSTLRPSPVHTSHPSI 295 P PT P P LP STS+LR S T P + Sbjct: 317 PVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPV 352
>YDQC_SCHPO (O14204) Hypothetical protein C5D6.12 in chromosome I| Length = 314 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Frame = +1 Query: 13 HFSSLKKAY*TETHYTGNNKPSETCD---GYFF----LRIHPYPIHTYHLNQN 150 H S+ + T +HY+ NN PS++ D YF + ++P + HL +N Sbjct: 29 HKSTSHSSTATSSHYSKNNLPSDSPDLLFDYFIDGHKIHVNPNAVEPLHLRRN 81
>ANTR1_MOUSE (Q9CZ52) Anthrax toxin receptor 1 precursor (Tumor endothelial| marker 8) Length = 562 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -1 Query: 402 PASRCPTLSAPAPTLPDGSSTSTLRPSP 319 PA CP + APT P S STL P P Sbjct: 515 PAPHCPPPAPSAPTPPIPSPPSTLPPPP 542
>PA23_OXYSC (P00616) Phospholipase A2, taipoxin gamma chain (EC 3.1.1.4)| (Phosphatidylcholine 2-acylhydrolase) Length = 133 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 187 CGCDCLRAVDVSCF---DSSGTCVWDMDGC 107 CG +CL +D C+ SGT + D+D C Sbjct: 23 CGSECLAYMDYGCYCGPGGSGTPIDDLDRC 52
>HEM1_HUMAN (P13196) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 640 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 366 PTLPDGSSTSTLRPSPVHTSHPSIYFVASLL 274 PT+P G + P+P HT YF+ +LL Sbjct: 561 PTVPRGEELLRIAPTPHHTPQMMNYFLENLL 591
>HEM1_CHICK (P07997) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 635 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 366 PTLPDGSSTSTLRPSPVHTSHPSIYFVASLL 274 PT+P G + P+P HT YF+ LL Sbjct: 556 PTVPRGEELLRIAPTPHHTPQMMSYFLEKLL 586
>RIHC_SHISS (Q3Z5Y0) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 175 CLRAVDVSCFDSSGTCVWDMDGCVGR 98 C AV+ +SGT V D+DGC+G+ Sbjct: 252 CFVAVETQGEFTSGTTVVDIDGCLGK 277
>RIHC_SHIFL (Q83MH0) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 175 CLRAVDVSCFDSSGTCVWDMDGCVGR 98 C AV+ +SGT V D+DGC+G+ Sbjct: 252 CFVAVETQGEFTSGTTVVDIDGCLGK 277
>RIHC_ECOLI (P22564) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 175 CLRAVDVSCFDSSGTCVWDMDGCVGR 98 C AV+ +SGT V D+DGC+G+ Sbjct: 252 CFVAVETQGEFTSGTTVVDIDGCLGK 277
>RIHC_ECOL6 (P0C0W2) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 175 CLRAVDVSCFDSSGTCVWDMDGCVGR 98 C AV+ +SGT V D+DGC+G+ Sbjct: 252 CFVAVETQGEFTSGTTVVDIDGCLGK 277
>RIHC_ECO57 (Q8XA41) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 175 CLRAVDVSCFDSSGTCVWDMDGCVGR 98 C AV+ +SGT V D+DGC+G+ Sbjct: 252 CFVAVETQGEFTSGTTVVDIDGCLGK 277
>EGR1_BRARE (P26632) Early growth response protein 1 (EGR-1) (Krox24)| Length = 511 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 387 PTLSAPAPTLPDGSSTSTLRPSPVHTSHPS 298 P S P+P S ++ SPVHTS+PS Sbjct: 428 PITSYPSPVSSFPSPVNSCYSSPVHTSYPS 457
>GA2L2_MOUSE (Q5SSG4) GAS2-like protein 2 (Growth arrest-specific 2-like 2)| Length = 860 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 398 LRGAQPFPPRLRLSLMGRARPRYAHRPSTR 309 LR Q P +L L R RPR HRP R Sbjct: 745 LRKPQKIPSIYKLKLRPRIRPRRDHRPEKR 774
>ANTR1_HUMAN (Q9H6X2) Anthrax toxin receptor 1 precursor (Tumor endothelial| marker 8) Length = 564 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 402 PASRCPTLSAPAPTLPDGSSTSTLRPSP 319 PA CP APT P S STL P P Sbjct: 517 PAPHCPPPPPSAPTPPIPSPPSTLPPPP 544
>PEPQ_ECOLI (P21165) Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase)| (Proline dipeptidase) (Prolidase) (Imidodipeptidase) Length = 443 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -1 Query: 381 LSAPAPTLPDGSSTSTLRPSPVHTSHPSIYFVASLL 274 L+APA P T L+P V T P IYF+ SLL Sbjct: 360 LAAPAK-YPYLRCTRILQPGMVLTIEPGIYFIESLL 394
>TRF2_THEVO (Q978U3) Tricorn protease-interacting factor F2 (EC 3.4.11.-)| Length = 783 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 202 MHAWLCSSGYFIVVATKKASEIDL*QASYEIDG 300 M AW+ +GY ++ K + I L Q + +DG Sbjct: 413 MEAWITKAGYPVLKVNKDGNRIRLTQEQFYLDG 445
>S27A5_MOUSE (Q4LDG0) Bile acyl-CoA synthetase (EC 6.2.1.7) (BACS) (Bile acid| CoA ligase) (BA-CoA ligase) (BAL) (Cholate--CoA ligase) (Very long chain acyl-CoA synthetase-related protein) (VLACS-related) (VLACSR) (Fatty acid transport protein 5) (FATP-5) Length = 689 Score = 27.3 bits (59), Expect = 8.9 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 8/84 (9%) Frame = -1 Query: 402 PASRCPTLSAPAPTLPDGSSTSTLRPSPVHTSHPSIYFVASLL*IDFASFFGCYYNKIAA 223 PAS T+ +P + +S +T P P SH + V+++L SF GC + + Sbjct: 276 PASLRATIKWKSPAIFIFTSGTTGLPKPAILSHERVIQVSNVL-----SFCGCRADDVVY 330 Query: 222 TT*PCMH--------V*CMHVAAT 175 P H + C+ V AT Sbjct: 331 DVLPLYHTIGLVLGFLGCLQVGAT 354
>HEM1_MOUSE (Q8VC19) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 642 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 366 PTLPDGSSTSTLRPSPVHTSHPSIYFVASLL 274 PT+P G + P+P HT +FV LL Sbjct: 563 PTVPRGEELLRIAPTPHHTPQMMNFFVEKLL 593
>GLF_ECOLI (P37747) UDP-galactopyranose mutase (EC 5.4.99.9)| Length = 367 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 52 HYTGNNKPSETCDGYFFLRIHPYPIHTYHLN 144 ++ G N +E C+G ++IH Y H +H N Sbjct: 34 NHIGGNAYTEDCEG---IQIHKYGAHIFHTN 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,156,248 Number of Sequences: 219361 Number of extensions: 1282380 Number of successful extensions: 4741 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 4470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4732 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)