| Clone Name | rbastl43h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CH60_PORPU (P51349) 60 kDa chaperonin (Protein Cpn60) (groEL pro... | 33 | 0.15 | 2 | FOLD_STRTR (P96050) FolD bifunctional protein [Includes: Methyle... | 30 | 2.2 | 3 | NFYA3_ARATH (Q93ZH2) Nuclear transcription factor Y subunit A-3 ... | 29 | 2.9 |
|---|
>CH60_PORPU (P51349) 60 kDa chaperonin (Protein Cpn60) (groEL protein)| Length = 528 Score = 33.5 bits (75), Expect = 0.15 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -3 Query: 165 TQDAG*DVCTVCVDFNWAGSHVPVTRPRMIWINDGEQGTLAGRCDQI 25 T+DAG + TV +D V VT+ I DG + T+ RC+QI Sbjct: 302 TEDAGFSLDTVQLDMLGKARRVVVTKDSTTIIADGHEATVKSRCEQI 348
>FOLD_STRTR (P96050) FolD bifunctional protein [Includes:| Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] Length = 284 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/27 (40%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +2 Query: 8 PPDTHHIWSQRPASVPCSPS-LIQIIR 85 P +T ++W+ RP VPC+P+ +++I+R Sbjct: 124 PMNTGNLWNGRPQMVPCTPAGIMEILR 150
>NFYA3_ARATH (Q93ZH2) Nuclear transcription factor Y subunit A-3 (AtNF-YA-3)| (Transcriptional activator HAP2C) Length = 340 Score = 29.3 bits (64), Expect = 2.9 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +2 Query: 41 PASVPCSPSLIQIIRGRVTGTWLPAQLKSTHTVHTS*PASCVVSRYRFTRQKL 199 P + C+P ++ +I GRV LPA+L T V + + R R R KL Sbjct: 152 PQAPTCNPQMVSMIPGRVP---LPAELTETDPVFVNAKQYHAIMRRRQQRAKL 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,926,915 Number of Sequences: 219361 Number of extensions: 678632 Number of successful extensions: 1459 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)