Clone Name | rbastl43f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RK4_ODOSI (P49546) Chloroplast 50S ribosomal protein L4 | 30 | 2.7 | 2 | CS120_WHEAT (P46525) Cold-shock protein CS120 | 29 | 5.9 | 3 | ENGC_PSEPK (Q88DC4) Probable GTPase engC (EC 3.6.1.-) | 28 | 7.7 |
---|
>RK4_ODOSI (P49546) Chloroplast 50S ribosomal protein L4| Length = 215 Score = 30.0 bits (66), Expect = 2.7 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 174 NSADTTSPTATTGLRSIAHSIQKSGSYL-HKVKNGHQDHQESGQISLTTATQ 326 NS D T + + + ++KSG+YL HK HQ Q G IS T ++ Sbjct: 10 NSVDINGKTLSDEYKLELNVLEKSGNYLIHKDILRHQSSQRQGTISTKTRSE 61
>CS120_WHEAT (P46525) Cold-shock protein CS120| Length = 391 Score = 28.9 bits (63), Expect = 5.9 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +3 Query: 198 TATTGLRSIAHSIQKSG---SYLHKVKNGHQDHQESG 299 T TGL AH+ +K G + K+ GHQDHQ++G Sbjct: 61 TTGTGLHG-AHAGEKKGVMENIKDKLPGGHQDHQQTG 96
>ENGC_PSEPK (Q88DC4) Probable GTPase engC (EC 3.6.1.-)| Length = 343 Score = 28.5 bits (62), Expect = 7.7 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 15/68 (22%) Frame = -2 Query: 366 ADLVN*ESLG*PH--------IGSPWLEKSVHFPDG-------LDAHFSLYGGMNQTSGW 232 ADL+N E+ H +G P LE S H DG LD H S++ G + G Sbjct: 165 ADLINDENGPGLHALLEVYRELGYPLLEVSAHHGDGMQRLQQQLDGHISVFVGQSGV-GK 223 Query: 231 SELLNAVL 208 S L+N++L Sbjct: 224 SSLVNSLL 231 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,684,700 Number of Sequences: 219361 Number of extensions: 1216668 Number of successful extensions: 2691 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2691 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)