ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl43f05 |
|---|---|
| Clone Library Name | barley_pub |
>KCO1_ARATH (Q8LBL1) Calcium-activated outward-rectifying potassium channel 1| (AtKCO1) Length = 363 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQAQS 209 DLD D VGAAEF+VYKLKE+GKI ++DIS ++EFE+LD D+SGTL+T D+ AQ+ Sbjct: 301 DLDEDGVVGAAEFIVYKLKEMGKIDEKDISGIMDEFEQLDYDESGTLTTSDIVLAQT 357
>KCO3_ARATH (Q9XFR0) Probable calcium-activated outward-rectifying potassium| channel 3 (AtKCO3) Length = 260 Score = 60.1 bits (144), Expect = 1e-09 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQAQS 209 D+DND ++ AEF +YKLK++ KI+QED +F+KLD QSG ++ DLT A S Sbjct: 203 DIDNDGRLSLAEFAIYKLKQMEKITQEDFIQICNQFDKLDRTQSGRITLVDLTTATS 259
>KCO6_ARATH (Q9SVV6) Probable calcium-activated outward-rectifying potassium| channel 6 (AtKCO6) Length = 436 Score = 52.4 bits (124), Expect = 3e-07 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQAQSG 206 D+DN+ V AE+V+YKLKE+ KI+ +DI ++F+KLD +G ++ DL + SG Sbjct: 378 DIDNNGCVSKAEYVIYKLKEMEKITDKDILPISKQFDKLDRCSNGKITLLDLLEGGSG 435
>KCO2_ARATH (Q9FL25) Probable calcium-activated outward-rectifying potassium| channel 2 (AtKCO2) Length = 443 Score = 48.1 bits (113), Expect = 5e-06 Identities = 23/57 (40%), Positives = 39/57 (68%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQAQS 209 D+D + V AEFV+YKLK++ KI+++DI+ +F+KLD SG ++ DL ++ + Sbjct: 378 DIDCNGCVSKAEFVIYKLKKMDKITEKDINPIGFQFDKLDRTNSGRITLLDLLESST 434
>KCO5_ARATH (Q9S6Z8) Probable calcium-activated outward-rectifying potassium| channel 5, chloroplast precursor (AtKCO5) Length = 408 Score = 46.2 bits (108), Expect = 2e-05 Identities = 21/45 (46%), Positives = 33/45 (73%) Frame = -3 Query: 358 VGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDL 224 + +E++V KLKE+GKI+Q+DI + +FEKLD +Q G ++ DL Sbjct: 359 ISKSEYIVLKLKEMGKITQKDIDQVVIQFEKLDPNQIGKITLPDL 403
>PLSI_CHICK (P19179) Plastin-1 (Fimbrin)| Length = 630 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 310 ISQEDISCFLEEFEKLDVDQSGTLSTYDL 224 IS+E++ E F K+D+D SG +S Y+L Sbjct: 8 ISREELEELREAFNKIDIDNSGYVSDYEL 36
>PLSI_HUMAN (Q14651) Plastin-1 (I-plastin) (Intestine-specific plastin)| Length = 629 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 310 ISQEDISCFLEEFEKLDVDQSGTLSTYDL 224 IS+E++ E F K+D+D SG +S Y+L Sbjct: 8 ISREELEELQEAFNKIDIDNSGYVSDYEL 36
>CAN2_PIG (P43367) Calpain-2 catalytic subunit (EC 3.4.22.53) (Calpain-2| large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) (Fragment) Length = 324 Score = 31.2 bits (69), Expect = 0.63 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF + K I + + + ++DVD+SGT+++Y++ +A Sbjct: 209 DSDGSAKLGLKEFYILWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 254
>CAN2_RABIT (P06814) Calpain-2 catalytic subunit (EC 3.4.22.53) (Calpain-2| large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) (Fragment) Length = 422 Score = 30.8 bits (68), Expect = 0.83 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF V K I + + + ++DVD+SGT+++Y++ +A Sbjct: 307 DSDGTGKLGLKEFYVLWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 352
>CAN2_MACFA (Q9GLG1) Calpain-2 catalytic subunit precursor (EC 3.4.22.53)| (Calpain-2 large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) Length = 699 Score = 30.8 bits (68), Expect = 0.83 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF + K I + + + ++DVD+SGT+++Y++ +A Sbjct: 584 DSDGSGKLGLKEFYILWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 629
>CAN2_HUMAN (P17655) Calpain-2 catalytic subunit precursor (EC 3.4.22.53)| (Calpain-2 large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) (Calpain large polypeptide L2) Length = 699 Score = 30.8 bits (68), Expect = 0.83 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF + K I + + + ++DVD+SGT+++Y++ +A Sbjct: 584 DSDGSGKLGLKEFYILWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 629
>EXO1_SCHPO (P53695) Exodeoxyribonuclease 1 (EC 3.1.-.-) (Exodeoxyribonuclease| I) (Exonuclease I) (EXO I) Length = 571 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +3 Query: 237 ESVPDWSTSSFSNSSRKQDMSSWLIFPSSLSLYTTNSAAPTFRSLSRS 380 E VP S ++ + +S K D +S + SS S T NSA+P F SLS + Sbjct: 468 EQVPSQSNNT-TPTSAKSDSASPQNWFSSFSYQTPNSASPPFSSLSHT 514
>CANX_CHICK (P00789) Calpain-1 catalytic subunit (EC 3.4.22.52) (Calpain-1| large subunit) (Calcium-activated neutral proteinase) (CANP) (Mu/M-type) Length = 705 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D ++G EF +I I +L F + D+D+SGT+S+Y++ A Sbjct: 589 DKDGSARLGLVEF---------QILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMA 634
>CAN2_RAT (Q07009) Calpain-2 catalytic subunit precursor (EC 3.4.22.53)| (Calpain-2 large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) Length = 699 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF + K I + + + ++DVD+SGT+++Y++ +A Sbjct: 584 DEDGSGKLGLKEFYILWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 629
>CAN2_MOUSE (O08529) Calpain-2 catalytic subunit precursor (EC 3.4.22.53)| (Calpain-2 large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) Length = 699 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF + K I + + + ++DVD+SGT+++Y++ +A Sbjct: 584 DEDGSGKLGLKEFYILWTK---------IQKYQKIYREIDVDRSGTMNSYEMRKA 629
>SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subunit (Sodium| channel protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (NaN) Length = 1765 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +3 Query: 246 PDWSTSSFSNSSRKQ---DMSSWLIFPSSLSLYTTNSAAP 356 P+ +T SF+ SR D SW + S ++LYT + AP Sbjct: 854 PNEATESFAGESRDTATLDTRSWKEYDSEMTLYTGQAGAP 893
>CAN9_HUMAN (O14815) Calpain-9 (EC 3.4.22.-) (Digestive tract-specific calpain)| (nCL-4) (CG36 protein) Length = 690 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 313 KISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 K+ + + ++ F + D D+SGT+STY+L A Sbjct: 587 KVFWDKLKQWINLFLRFDADKSGTMSTYELRTA 619
>ATX1_ARATH (Q9C5X4) Histone-lysine N-methyltransferase, H3 lysine-4 specific| ATX1 (EC 2.1.1.43) (H3-K4-HMTase) (Trithorax-homolog protein 1) (TRX-homolog protein 1) (Protein SET DOMAIN GROUP 27) Length = 1062 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 167 SCRIKYKPICSSLTGLCL 220 SCR+ Y P+C+ GLC+ Sbjct: 741 SCRVAYHPLCARAAGLCV 758
>CAN9_MOUSE (Q9D805) Calpain-9 (EC 3.4.22.-) (Digestive tract-specific calpain)| (nCL-4) Length = 690 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 7/41 (17%) Frame = -3 Query: 316 GKISQEDISCFLEE-------FEKLDVDQSGTLSTYDLTQA 215 GK+ E+ F ++ F + DVD+SGT+S+Y+L A Sbjct: 579 GKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTA 619
>YL089_MIMIV (Q5UPG9) Putative BTB/POZ domain-containing protein L89| Length = 502 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -3 Query: 364 RKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDL 224 +K ++ YK + KI +DI C++ E+ ++ V SG + +DL Sbjct: 263 KKYTVKKYFFYKNNK--KILPKDIVCYIPEYNQVIVGNSGYIDLFDL 307
>CAN2_CHICK (Q92178) Calpain-2 catalytic subunit precursor (EC 3.4.22.53)| (Calpain-2 large subunit) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (M-calpain) (Millimolar-calpain) Length = 699 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -3 Query: 376 LDNDR--KVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 LDND K+G EF K I + + + ++DVD+SGT+++Y++ +A Sbjct: 583 LDNDGSGKLGLKEFHTLWTK---------IQKYQKIYREIDVDRSGTMNSYEMRRA 629
>CAN9_RAT (O35920) Calpain-9 (EC 3.4.22.-) (Digestive tract-specific calpain)| (nCL-4) (Fragment) Length = 674 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = -3 Query: 313 KISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 ++ + + +++ F + DVD+SGT+S+Y+L A Sbjct: 571 RVFWDKLRYWMDLFLQFDVDKSGTMSSYELRTA 603
>CALL2_ARATH (Q9SRP5) Calmodulin-like protein 2| Length = 131 Score = 28.1 bits (61), Expect = 5.4 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLT 221 D + D K+ EF L +QEDI F FE++DVD +G L+ + T Sbjct: 11 DKNKDGKLSLDEFREVALAFSPYFTQEDIVKF---FEEIDVDGNGELNADEFT 60
>BNIPL_MOUSE (Q99JU7) Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like| protein Length = 328 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +1 Query: 211 IVPE*GHRWRVCRTGQ--HRVSQT 276 + E GHRWRV RTGQ RV T Sbjct: 141 VAGEDGHRWRVFRTGQREQRVDMT 164
>ATX2_ARATH (Q9MA43) Histone-lysine N-methyltransferase ATX2 (EC 2.1.1.43)| (Trithorax-homolog protein 2) (TRX-homolog protein 2) (Protein SET DOMAIN GROUP 30) Length = 1193 Score = 27.7 bits (60), Expect = 7.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 167 SCRIKYKPICSSLTGLCL 220 +CR+ Y P+C+ GLC+ Sbjct: 725 TCRVAYHPLCARAAGLCV 742
>CANB2_MOUSE (Q63811) Calcineurin subunit B isoform 2 (Protein phosphatase 2B| regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform) Length = 178 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 334 YKLKELGKISQEDISCFLEEFEKLDVDQSGTLS 236 Y+ + QE+I + F KLD+D+SG+LS Sbjct: 6 YQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLS 38
>NODN_RHIME (P25200) Nodulation protein N| Length = 161 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 30 THVRVHMSRSIVLNTCRSSTRSYLLTLYKITELINSINRP 149 T RVH VL+ CR S L+T Y +T I + N+P Sbjct: 103 TGSRVH--GRFVLSDCRLRRASILMTAYNVTVEIENENKP 140
>YETS4_MOUSE (Q9CR11) YEATS domain-containing protein 4| Length = 227 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 343 FVVYKLKELGKISQEDISCFLEEFEKLDVD 254 F + +LKE K S+E I+C E KL+ D Sbjct: 192 FEIAELKERLKASRETINCLKNEIRKLEED 221
>YETS4_HUMAN (O95619) YEATS domain-containing protein 4 (Glioma-amplified| sequence-41) (Gas41) (NuMA-binding protein 1) (NuBI-1) (NuBI1) Length = 227 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 343 FVVYKLKELGKISQEDISCFLEEFEKLDVD 254 F + +LKE K S+E I+C E KL+ D Sbjct: 192 FEIAELKERLKASRETINCLKNEIRKLEED 221
>METE_PYRFU (Q8TH63) Probable methylcobalamin:homocysteine methyltransferase| (EC 2.1.1.-) (Methionine synthase) Length = 338 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 10/50 (20%) Frame = -3 Query: 337 VYKLKELGKISQEDIS--------CFLEEFEK--LDVDQSGTLSTYDLTQ 218 +YKL+ELGKI +ED L E E+ +D+ G + ++T+ Sbjct: 23 MYKLRELGKIPEEDFKEAVRDASISVLREHERAGIDIPWDGEMGRSEMTE 72
>PRVB_GADCA (P02622) Parvalbumin beta (Allergen Gad c 1) (Gad c I) (Allergen M)| Length = 113 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 361 KVGAAEFVVYKLKELGKISQEDISCFLEEFE 269 KVG F +LK+L KI+ ED F+EE E Sbjct: 32 KVGLDAFSADELKKLFKIADEDKEGFIEEDE 62
>GRAN_MOUSE (Q8VC88) Grancalcin| Length = 220 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = -3 Query: 379 DLDNDRKVGAAEFVVYKLKELGKISQEDISCFLEEFEKLDVDQSGTLSTYDLTQA 215 D D K+G EF KEL ++ + + F +D DQSGT+ ++L+QA Sbjct: 105 DRDYTGKMGFNEF-----KELWAA----LNAWKQNFMTIDQDQSGTVEHHELSQA 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,453,949 Number of Sequences: 219361 Number of extensions: 977267 Number of successful extensions: 2621 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2621 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
