Clone Name | rbastl43c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CSD_MYCGE (Q49420) Probable cysteine desulfurase (EC 2.8.1.7) | 30 | 2.5 | 2 | BRO1_CANGA (Q6FJG8) Vacuolar protein-sorting protein BRO1 (BRO d... | 28 | 7.4 | 3 | MATK_TAXBA (Q9MVV8) Maturase K (Intron maturase) | 28 | 9.7 | 4 | MATK_TAXCU (Q7IS11) Maturase K (Intron maturase) | 28 | 9.7 |
---|
>CSD_MYCGE (Q49420) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 408 Score = 30.0 bits (66), Expect = 2.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 23 ITEQMKFVQKTLN*SITIFTLLQVKYAYYNLLSQ 124 + +Q+KF+QK N S +F Q+K Y LLSQ Sbjct: 286 LNKQLKFMQKEFNFSEMVFYSKQLKNLAYQLLSQ 319
>BRO1_CANGA (Q6FJG8) Vacuolar protein-sorting protein BRO1 (BRO| domain-containing protein 1) Length = 888 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +2 Query: 11 YFEQITEQMKFVQKTLN*SITIFTLLQVKYAYYNLLSQYMICYSLHIG 154 Y EQ+ +M V+ N + TL++ Y YY L Q + +IG Sbjct: 39 YDEQLCVEMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIG 86
>MATK_TAXBA (Q9MVV8) Maturase K (Intron maturase)| Length = 504 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 74 IFTLLQVKYAYYNLLSQYMICYSLH 148 IFTL++ K+ Y N +S + YS+H Sbjct: 133 IFTLMEDKFPYSNYVSDIRVPYSIH 157
>MATK_TAXCU (Q7IS11) Maturase K (Intron maturase)| Length = 510 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 74 IFTLLQVKYAYYNLLSQYMICYSLH 148 IFTL++ K+ Y N +S + YS+H Sbjct: 133 IFTLMEDKFPYSNYVSDIRVPYSIH 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,250,062 Number of Sequences: 219361 Number of extensions: 846254 Number of successful extensions: 2168 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2168 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)