Clone Name | rbastl43c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CY24A_RAT (Q62737) Cytochrome b-245 light chain (p22 phagocyte B... | 29 | 5.2 | 2 | CHI3_CANAL (P40954) Chitinase 3 precursor (EC 3.2.1.14) | 29 | 6.8 |
---|
>CY24A_RAT (Q62737) Cytochrome b-245 light chain (p22 phagocyte B-cytochrome)| (Neutrophil cytochrome b 22 kDa polypeptide) (p22-phox) (p22phox) (Cytochrome b(558) alpha chain) (Cytochrome b558 alpha subunit) (Superoxide-generating NADPH oxidase light chai Length = 191 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 46 RAKRKKGKS*QRCSLYKGLQPTMDISTS*SKNYYCMAITRVKTTIP 183 R KRKKG + +RC K L + + ++NYY A+ + ++P Sbjct: 55 RGKRKKGSTMERCG-QKYLTAVVKLFGPLTRNYYVRAVLHLLLSVP 99
>CHI3_CANAL (P40954) Chitinase 3 precursor (EC 3.2.1.14)| Length = 567 Score = 28.9 bits (63), Expect = 6.8 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 323 TTAVIISLPASGKVSCCISTSSTEKHLASRPLACTSSFLTGSTSSN 460 T+ I S +S K S +TS+T ++S + TSS + STSS+ Sbjct: 331 TSTTISSSSSSSKTSKTSTTSTTSSSISSTTSSTTSSTSSSSTSSS 376 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,508,617 Number of Sequences: 219361 Number of extensions: 933211 Number of successful extensions: 3015 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3013 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)