Clone Name | rbastl43b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GATB_MYCLE (O33107) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe... | 28 | 7.4 | 2 | FREM2_LYTVA (Q9GV77) Extracellular matrix protein 3 precursor (F... | 27 | 9.7 | 3 | MRAY_SYNAS (Q2LR51) Phospho-N-acetylmuramoyl-pentapeptide-transf... | 27 | 9.7 |
---|
>GATB_MYCLE (O33107) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit| B (EC 6.3.5.-) (Asp/Glu-ADT subunit B) Length = 509 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 96 TVVVGQSSTNGVGLLDRSIFLGHNDDVFNLDL 1 TVV G S +G LLD + + D VF L++ Sbjct: 2 TVVSGASKASGADLLDYDVVVARFDPVFGLEV 33
>FREM2_LYTVA (Q9GV77) Extracellular matrix protein 3 precursor (FREM2 homolog)| Length = 3103 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -3 Query: 213 YLPEIFYHPTCEE*V*YNWFHCVVSSP---FFFCVIDRSRPDTVV 88 Y+P+ Y+P E + CV +P + F ++DR PDT+V Sbjct: 2887 YIPK--YNPAANE------YGCVADTPNLLYAFKILDRGAPDTIV 2923
>MRAY_SYNAS (Q2LR51) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 359 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 15 IHHHCALKIWICPKVLHRLLMI 80 IHHH LK W PKV+ R +I Sbjct: 323 IHHHFELKGWAEPKVIVRFWII 344 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,428,609 Number of Sequences: 219361 Number of extensions: 750046 Number of successful extensions: 1718 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)