Clone Name | rbastl43b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y603_ENCCU (Q8STJ4) Hypothetical protein ECU06_0030/ECU06_1690/E... | 28 | 6.6 |
---|
>Y603_ENCCU (Q8STJ4) Hypothetical protein ECU06_0030/ECU06_1690/ECU11_0020| Length = 248 Score = 28.5 bits (62), Expect = 6.6 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +2 Query: 185 HSIQMIPLFHSSKSSQPSMHGTRFPDHDYSVIHPFSRKELHIKWSYKSSP 334 HS ++P K++ P+ R+P H HP SR LH++ + SP Sbjct: 4 HSKNILP-----KTTNPNPESNRYPPHPADPSHP-SRYHLHLQAHHLRSP 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,610,725 Number of Sequences: 219361 Number of extensions: 1405483 Number of successful extensions: 3210 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3210 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)