Clone Name | rbastl43a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BCP_PEA (Q41001) Blue copper protein precursor | 30 | 2.1 | 2 | JP650_ARATH (P92990) Probable polygalacturonase non-catalytic su... | 28 | 6.1 | 3 | TYDC2_ARATH (Q9M0G4) Probable tyrosine decarboxylase 2 (EC 4.1.1... | 28 | 8.0 |
---|
>BCP_PEA (Q41001) Blue copper protein precursor| Length = 189 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 121 QG*SMVINLPPVLCVFFTFSWLCKLQLI 38 Q S +L P++ +FFT SW+C L+ Sbjct: 162 QNESSATSLSPIVALFFTVSWICSYVLV 189
>JP650_ARATH (P92990) Probable polygalacturonase non-catalytic subunit JP650| precursor (Aromatic-rich glycoprotein JP650) Length = 626 Score = 28.1 bits (61), Expect = 6.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -2 Query: 174 CHPLPK----EAHVSLELYLPSKVEAW*LICHQYCAYFSPFHGYVNCNSSRQEQLNLC 13 CH +PK EA + LEL K+ ICH + + P HG S+ ++ +C Sbjct: 556 CHSVPKVRVYEADL-LELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVC 612
>TYDC2_ARATH (Q9M0G4) Probable tyrosine decarboxylase 2 (EC 4.1.1.25)| Length = 545 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 256 IHLVWLTNRAHIQMEIILLSYALEMLYLP 170 + WLT+ A ++EII+L + ++L LP Sbjct: 164 VGFTWLTSPAATELEIIVLDWLAKLLQLP 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,295,335 Number of Sequences: 219361 Number of extensions: 931233 Number of successful extensions: 2078 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2078 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)