| Clone Name | rbastl43a10 |
|---|---|
| Clone Library Name | barley_pub |
>MSMG_STRMU (Q00751) Multiple sugar-binding transport system permease protein| msmG Length = 277 Score = 28.9 bits (63), Expect = 3.6 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = -2 Query: 182 LLTNSVWFWW*FLVPVTSISRAAGMFKFP 96 L+ N++WFW F++P+ +++ + M+ P Sbjct: 200 LIINALWFWNDFMLPLLILNKDSSMWTLP 228
>TPT_SPIOL (P11869) Triose phosphate/phosphate translocator, chloroplast| precursor (cTPT) (p36) (E29) Length = 404 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -2 Query: 194 RYPMLLTNSVWFWW*FLVPVTSI--SRAAGMFKFPPPIS*LHL 72 +YP L+T S +F W FL + +I + F +P +S +HL Sbjct: 96 KYPALVTGSFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHL 138
>SYP_CLOST (Q9L4Q8) Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA| ligase) (ProRS) Length = 481 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +2 Query: 35 SYSPNWKFGNYDTDGV-RRLEV 97 +YSP WKF Y+ GV RLE+ Sbjct: 332 NYSPGWKFNQYEMKGVPLRLEI 353
>TIMD4_HUMAN (Q96H15) T-cell immunoglobulin and mucin domain-containing protein| 4 precursor (TIMD-4) (T-cell membrane protein 4) (TIM-4) Length = 378 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 197 NRYPMLLTNSVWFWW*FLVPVTS 129 ++ P++L + FWW +L PVTS Sbjct: 2 SKEPLILWLMIEFWWLYLTPVTS 24
>OSTA_SHIFL (Q83SQ0) Organic solvent tolerance protein precursor| Length = 784 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 151 NSWYQSRRSAEQLVCSNFHLQSPDSICVIVPK 56 NS + RR ++LV N+H SP+ I +PK Sbjct: 639 NSSIEYRRDEDRLVQLNYHYASPEYIQATLPK 670
>THYG_MOUSE (O08710) Thyroglobulin precursor| Length = 2766 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 43 PKLEVWEL*HRWSQEIGGGNLNIPAALLIDVTGTKNY-HQNHTLFVSNI 186 P +V+E RW + G G PAALL+ + + +N +LF+ ++ Sbjct: 777 PHEQVFEWYERWKTQNGDGQELTPAALLMKIVSYREVASRNFSLFLQSL 825 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,503,916 Number of Sequences: 219361 Number of extensions: 753289 Number of successful extensions: 1722 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1722 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)