Clone Name | rbastl43a04 |
---|---|
Clone Library Name | barley_pub |
>MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1| Length = 2042 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 Query: 191 RCCKKTSTASNPAPHGMTMSHATPKRSPRGLAYRS 295 R KT AS P P T TPK + RG A+RS Sbjct: 1347 RSSVKTPAASEPLPSASTDQPITPKPTSRGRAHRS 1381
>RAC2_CAVPO (O88931) Ras-related C3 botulinum toxin substrate 2 precursor| (p21-Rac2) Length = 192 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +2 Query: 26 LLCFQAIH-SSFEPVH--WYPIDDHNCPRSEL 112 L+CF + +S+E VH WYP H+CP + + Sbjct: 79 LICFSLVSPASYENVHANWYPKVRHHCPSTPI 110
>RAC1_DROME (P40792) Ras-related protein Rac1| Length = 192 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 16/75 (21%) Frame = +2 Query: 26 LLCFQAIH-SSFEPVH--WYPIDDHNCP-------------RSELPVSRFLLD*MLETIS 157 L+CF ++ +SFE V WYP H+CP R + L D L I+ Sbjct: 79 LICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPIT 138 Query: 158 YPPDLLLCNPMRCCK 202 YP L + + K Sbjct: 139 YPQGLAMAKEIGAVK 153
>CO8A_MOUSE (Q8K182) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 587 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 224 GCWPCWSSCSSALDCRGGDQ 165 G W CWSS S +CRGG Q Sbjct: 543 GHWSCWSSWS---ECRGGSQ 559
>RAC3_MOUSE (P60764) Ras-related C3 botulinum toxin substrate 3 (p21-Rac3)| Length = 192 Score = 27.7 bits (60), Expect = 7.7 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 16/75 (21%) Frame = +2 Query: 26 LLCFQAIH-SSFEPVH--WYPIDDHNCP-------------RSELPVSRFLLD*MLETIS 157 L+CF + +SFE V WYP H+CP R + L D L I+ Sbjct: 79 LICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPIT 138 Query: 158 YPPDLLLCNPMRCCK 202 YP L + + K Sbjct: 139 YPQGLAMAREIGSVK 153
>RAC3_HUMAN (P60763) Ras-related C3 botulinum toxin substrate 3 (p21-Rac3)| Length = 192 Score = 27.7 bits (60), Expect = 7.7 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 16/75 (21%) Frame = +2 Query: 26 LLCFQAIH-SSFEPVH--WYPIDDHNCP-------------RSELPVSRFLLD*MLETIS 157 L+CF + +SFE V WYP H+CP R + L D L I+ Sbjct: 79 LICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPIT 138 Query: 158 YPPDLLLCNPMRCCK 202 YP L + + K Sbjct: 139 YPQGLAMAREIGSVK 153
>KCNAS_DROME (P08510) Potassium voltage-gated channel protein Shaker| Length = 655 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 62 PVHWYPID-DHN-CPRSELPVSRFLLD*MLETISYPPDLLLCNPMR 193 P H+ PI DH+ C R + VS + L T++ PD LL +P R Sbjct: 83 PQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPAR 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,108,226 Number of Sequences: 219361 Number of extensions: 819408 Number of successful extensions: 2354 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2348 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)