Clone Name | rbastl42h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATS10_MOUSE (P58459) ADAMTS-10 (EC 3.4.24.-) (A disintegrin and ... | 30 | 3.5 | 2 | Y904_TREPA (O83874) Hypothetical protein TP0904 | 29 | 5.9 | 3 | SELA_DESBA (P56372) L-seryl-tRNA(Sec) selenium transferase (EC 2... | 29 | 5.9 |
---|
>ATS10_MOUSE (P58459) ADAMTS-10 (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 10) (ADAM-TS 10) (ADAM-TS10) (Fragment) Length = 450 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = -1 Query: 268 ERKF*KAREN*KDDENCHQ------EKLQGPMCPAPWCKL 167 +R+ A E DD C Q E QGPMCP W L Sbjct: 258 QRRVSAAEEKALDDSACPQPRPPVLEACQGPMCPPEWATL 297
>Y904_TREPA (O83874) Hypothetical protein TP0904| Length = 83 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = +1 Query: 175 TRERGT-SALAIFLGDSFHRPSS-----FPLLFKIFSLYKERIDHHTPPLFLQPFRTTC 333 T+++GT +AL +FL ++R S+ PLL +FS+ + + H T + L+ C Sbjct: 5 TQDKGTPAALQVFLLPQYNRYSAEMTRHVPLLCNLFSMSRYVLRHLTAQIILERMSAAC 63
>SELA_DESBA (P56372) L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)| (Cysteinyl-tRNA(Sec) selenium transferase) (Selenocysteine synthase) (Selenocysteinyl-tRNA(Sec) synthase) Length = 465 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 17 ILGE*QPLTTANGCYHYQNLELQRTTVCSGTK 112 IL E L A GC HY NLE+ T G++ Sbjct: 98 ILAEEAVLAVAEGCRHYSNLEMDLDTGQRGSR 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,095,828 Number of Sequences: 219361 Number of extensions: 1239749 Number of successful extensions: 2827 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2827 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)