Clone Name | rbastl42g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATY1_ARATH (Q9LT02) Putative cation-transporting ATPase (EC 3.6.... | 84 | 2e-16 | 2 | CXA5_CHICK (P18860) Gap junction alpha-5 protein (Connexin-42) (... | 28 | 8.6 |
---|
>ATY1_ARATH (Q9LT02) Putative cation-transporting ATPase (EC 3.6.3.-)| Length = 1179 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -2 Query: 458 LEPLPEGMRGKLLLWAMLMFCGCYGWERFLRWAFPGKMPAWEKRQKQAVANLDKKQ 291 L PLP+G+R KLL+WA LMF CY WER LRWAFPGK+ +W+ +Q+ ANL+KK+ Sbjct: 1122 LVPLPQGLRDKLLIWASLMFIICYSWERLLRWAFPGKISSWKHKQRAVTANLEKKK 1177
>CXA5_CHICK (P18860) Gap junction alpha-5 protein (Connexin-42) (Cx42)| Length = 368 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 6/44 (13%) Frame = +3 Query: 318 LFLSLLPCWHLAWERPSQ------KPLPSIATAKHKHSPKQQFA 431 LFLSL +HL W++ + KP PS A + + +P+ + A Sbjct: 223 LFLSLAELYHLGWKKAKERCSRAYKPSPSTAPRRLESAPQVERA 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,248,287 Number of Sequences: 219361 Number of extensions: 1531293 Number of successful extensions: 3615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3613 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)