Clone Name | rbastl42f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRME_MYCPU (Q98RJ5) tRNA modification GTPase trmE | 28 | 7.6 | 2 | CGL_MOUSE (Q8VCN5) Cystathionine gamma-lyase (EC 4.4.1.1) (Gamma... | 28 | 7.6 | 3 | ZN563_HUMAN (Q8TA94) Zinc finger protein 563 | 28 | 9.9 |
---|
>TRME_MYCPU (Q98RJ5) tRNA modification GTPase trmE| Length = 442 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 235 IIGGCCIIVNYCHICDLARLTSACLLPNMKPLS*EV 128 IIG C + ++Y D+ LT LLP +K L E+ Sbjct: 164 IIGTCEVNIDYPEYDDIEELTLEVLLPKLKDLEKEI 199
>CGL_MOUSE (Q8VCN5) Cystathionine gamma-lyase (EC 4.4.1.1)| (Gamma-cystathionase) Length = 398 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +2 Query: 101 ASLSK--PSMMHFSTQRLHVGQK 163 ASLS PS HF+TQ +HVGQ+ Sbjct: 5 ASLSGFLPSFQHFATQAIHVGQE 27
>ZN563_HUMAN (Q8TA94) Zinc finger protein 563| Length = 476 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +2 Query: 35 GGHRIEKKK*SSIQNMQCRTCIASLSKPSMMHFSTQRLHVGQKAGAGESCQVT 193 G +I K+ + + +C+ C +PS++ + +R+H G+K + C T Sbjct: 322 GSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYH-ERIHTGEKPYECKQCGKT 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,274,960 Number of Sequences: 219361 Number of extensions: 1319650 Number of successful extensions: 2630 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2630 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)