Clone Name | rbastl42b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AT12A_RABIT (Q9TV52) Potassium-transporting ATPase alpha chain 2... | 31 | 0.71 | 2 | COL_PIG (P02703) Colipase precursor (Procolipase II) | 28 | 4.6 | 3 | TLC2_CHLPN (Q9Z7U0) ADP,ATP carrier protein 2 (ADP/ATP transloca... | 28 | 6.0 | 4 | AT12A_CAVPO (Q64392) Potassium-transporting ATPase alpha chain 2... | 28 | 6.0 | 5 | COL_HUMAN (P04118) Colipase precursor | 28 | 7.8 | 6 | COL_SPETR (Q91XL7) Colipase precursor | 28 | 7.8 |
---|
>AT12A_RABIT (Q9TV52) Potassium-transporting ATPase alpha chain 2 (EC 3.6.3.10)| (Proton pump) (Non-gastric H(+)/K(+) ATPase alpha subunit) (HK alpha 2) Length = 1094 Score = 31.2 bits (69), Expect = 0.71 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 12 WLTFGIKFVAKVGTSVVTIYMRYVAATI*ITCGC----NNLNNKTHESDFVKITPKISHI 179 W+ FGI++V+ S+ +Y+ V A + I G + + F K+ P+ + + Sbjct: 182 WIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAYYQEAKSTNIMASFCKMIPQQAVV 241 Query: 180 YRDQE 194 RD E Sbjct: 242 IRDSE 246
>COL_PIG (P02703) Colipase precursor (Procolipase II)| Length = 112 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 113 AATCYSNCCSHITHVNCHNRCANFGNEFNTEC 18 +A C SNCC H T ++ +RCA E N+EC Sbjct: 37 SAQCKSNCCQHDTILSL-SRCALKARE-NSEC 66
>TLC2_CHLPN (Q9Z7U0) ADP,ATP carrier protein 2 (ADP/ATP translocase 2)| Length = 540 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 20 IRY*IRCQSWHICCDNLHALCGCNNLNNMWL 112 + Y C SWH NL L C+ L +WL Sbjct: 212 VAYSFACDSWHSVMLNLTMLITCSGLIMIWL 242
>AT12A_CAVPO (Q64392) Potassium-transporting ATPase alpha chain 2 (EC 3.6.3.10)| (Proton pump) (Non-gastric H(+)/K(+) ATPase alpha subunit) Length = 1033 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +3 Query: 12 WLTFGIKFVAKVGTSVVTIYMRYVAATI*ITCGC----NNLNNKTHESDFVKITPKISHI 179 W+ +GI++ + S+ +Y+ V A + I G + S F K+ P+ + + Sbjct: 121 WIAYGIQYASNQSGSLDNVYLGVVLALVVILTGIFAYYQEAKSTNIMSSFSKMIPQEALV 180 Query: 180 YRDQE 194 RD E Sbjct: 181 TRDAE 185
>COL_HUMAN (P04118) Colipase precursor| Length = 112 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 113 AATCYSNCCSHITHVNCHNRCANFGNEFNTEC 18 +A C SNCC H + + RC + +E N+EC Sbjct: 37 SAQCKSNCCQHSSALGL-ARCTSMASE-NSEC 66
>COL_SPETR (Q91XL7) Colipase precursor| Length = 111 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 113 AATCYSNCCSHITHVNCHNRCANFGNEFNTECEP 12 +A C S+CC H + + RC +E N+EC P Sbjct: 36 SAQCKSSCCQHFSPLGV-ARCTRKASE-NSECSP 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,376,312 Number of Sequences: 219361 Number of extensions: 762333 Number of successful extensions: 1846 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1846 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)