| Clone Name | rbastl42b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore... | 28 | 8.6 |
|---|
>RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein| Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) Length = 3224 Score = 27.7 bits (60), Expect = 8.6 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Frame = +2 Query: 47 LVNNATNITPSDDFCVKLNGIFPILLVYAA-----CPPLPS--CCLFSLAIHGPASL 196 L+ A N+TP+ +N + P +YA PP+ S C+FS ++GP +L Sbjct: 888 LLRPAANVTPTKGPVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPAL 944 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,370,993 Number of Sequences: 219361 Number of extensions: 486690 Number of successful extensions: 1331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1331 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)