>RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein|
            Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270)
          Length = 3224

 Score = 27.7 bits (60), Expect = 8.6
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%)
 Frame = +2

Query: 47   LVNNATNITPSDDFCVKLNGIFPILLVYAA-----CPPLPS--CCLFSLAIHGPASL 196
            L+  A N+TP+      +N + P   +YA       PP+ S   C+FS  ++GP +L
Sbjct: 888  LLRPAANVTPTKGPVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPAL 944


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,370,993
Number of Sequences: 219361
Number of extensions: 486690
Number of successful extensions: 1331
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1323
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1331
length of database: 80,573,946
effective HSP length: 44
effective length of database: 70,922,062
effective search space used: 1702129488
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)