Clone Name | rbastl42a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LRTM1_PONPY (Q5R6B1) Leucine-rich repeat transmembrane neuronal ... | 28 | 6.0 | 2 | LRTM1_HUMAN (Q86UE6) Leucine-rich repeat transmembrane neuronal ... | 28 | 6.0 |
---|
>LRTM1_PONPY (Q5R6B1) Leucine-rich repeat transmembrane neuronal protein 1| precursor Length = 522 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 64 VLGTVLYWQRDVPSRRT-----ACFTLAPSKTKGCKQKAMTETKL 183 +LG LYW PS ACF + P+ GC Q E +L Sbjct: 5 LLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRL 49
>LRTM1_HUMAN (Q86UE6) Leucine-rich repeat transmembrane neuronal protein 1| precursor Length = 522 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 64 VLGTVLYWQRDVPSRRT-----ACFTLAPSKTKGCKQKAMTETKL 183 +LG LYW PS ACF + P+ GC Q E +L Sbjct: 5 LLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRL 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,932,785 Number of Sequences: 219361 Number of extensions: 829452 Number of successful extensions: 1703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)