Clone Name | rbastl41f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RCC1_DROME (P25171) Regulator of chromosome condensation (Chroma... | 28 | 5.8 | 2 | CI079_HUMAN (Q6ZUB1) Protein C9orf79 | 27 | 9.9 | 3 | ZFNL1_ARATH (Q84W91) Zinc finger CCCH type domain-containing pro... | 27 | 9.9 | 4 | HEMN_PASHA (P95506) Oxygen-independent coproporphyrinogen III ox... | 27 | 9.9 |
---|
>RCC1_DROME (P25171) Regulator of chromosome condensation (Chromatin-binding| protein Bj1) Length = 547 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 185 QYLVLWLGERKNTPENPCVVRSVFEDVIGLYWGRACS 75 +Y L LG+ K+ E P +V+ + E ++ + G CS Sbjct: 321 EYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCS 357
>CI079_HUMAN (Q6ZUB1) Protein C9orf79| Length = 1445 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 170 WLGERKNTPENPCVVRSVFEDVIGLYWGRACSVFFVERVLQKP 42 WL +P +PC R++ IG W RA +V +KP Sbjct: 1000 WLESESMSPGDPCSSRALQVLSIGSQWARAEDALQALKVGEKP 1042
>ZFNL1_ARATH (Q84W91) Zinc finger CCCH type domain-containing protein ZFN-like 1| Length = 468 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 25 TSFPLQGFCKTLSTKKTEHALP--QYNPMTSSKTD 123 T + GFCK ST K +H + +YNP SS D Sbjct: 342 TFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLAD 376
>HEMN_PASHA (P95506) Oxygen-independent coproporphyrinogen III oxidase (EC| 1.3.99.22) (Coproporphyrinogenase) (Coprogen oxidase) (Fragment) Length = 146 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 168 VRRKKKYPRKPLCC*VSF*GCHRVILGKSMFCFFCG 61 +R +YP +PL V CH++ C+FCG Sbjct: 40 IRAAARYPERPLSLYVHIPFCHKL-------CYFCG 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,877,736 Number of Sequences: 219361 Number of extensions: 883537 Number of successful extensions: 1860 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1859 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)