| Clone Name | rbastl41f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL11_MYCPE (Q8EX25) 50S ribosomal protein L11 | 30 | 1.8 | 2 | ACO1_AJECA (Q12618) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl... | 30 | 3.0 | 3 | YJGX_ECOLI (P39349) Hypothetical UPF0141 protein yjgX precursor | 29 | 5.2 | 4 | SPO11_CAEEL (Q22236) Meiotic recombination protein spo-11 | 29 | 5.2 | 5 | Y131_UREPA (Q9PR13) Hypothetical protein UU131 | 28 | 6.7 | 6 | RL11_UREPA (Q9PPU9) 50S ribosomal protein L11 | 28 | 6.7 | 7 | RL11_BORBU (O51354) 50S ribosomal protein L11 | 28 | 8.8 |
|---|
>RL11_MYCPE (Q8EX25) 50S ribosomal protein L11| Length = 155 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 16 TYSIGIAPSNNLLQSLSRIQITENSKNRDTVATVSVGKKMEVSRIDL 156 T+ I P LL+ + I++ + +TVAT+S K +E+++ L Sbjct: 69 TFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKL 115
>ACO1_AJECA (Q12618) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-CoA| desaturase) (Fatty acid desaturase) (Delta(9)-desaturase) Length = 476 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -3 Query: 364 QLLCHCSRMNTQMCADSTAEVGSPHLDGYLRWDALGCHCHIRYVN 230 +L HCS T A VG ++G +RW A G H RY + Sbjct: 102 RLWAHCSYSATLPLKIYLAAVGGGAVEGSIRWWARGHRAHHRYTD 146
>YJGX_ECOLI (P39349) Hypothetical UPF0141 protein yjgX precursor| Length = 371 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = +3 Query: 318 SAHICVFILLQW------HNNWMELRLYVFDQV 398 SA I VF+++ W H NW+ LRL+V V Sbjct: 14 SAAILVFVVIFWRTHHRDHRNWLALRLFVLCSV 46
>SPO11_CAEEL (Q22236) Meiotic recombination protein spo-11| Length = 425 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -2 Query: 224 IFIPFQDTTDEYLVTTNFVALFSKSILETSIFFPTETVATVSLFLLFS 81 I + +DTT + L+ NF A+F + IL TS +P +AT ++ + S Sbjct: 198 ILVVEKDTTFQKLMDENFQAMFPRGILATSKGYP--DIATRNVLKMLS 243
>Y131_UREPA (Q9PR13) Hypothetical protein UU131| Length = 268 Score = 28.5 bits (62), Expect = 6.7 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -3 Query: 271 WDALGCHCHIRYVNHRSSFLFRTQQMNTW 185 ++AL H H +++NH ++ F T+ ++ W Sbjct: 124 YEALHYHAHSKFINHNGTWGFVTKVLSDW 152
>RL11_UREPA (Q9PPU9) 50S ribosomal protein L11| Length = 150 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 19 YSIGIAPSNNLLQSLSRIQITENSKNRDTVATVSVGKKMEVSRIDL 156 Y I P LL+ +++I+ + TVAT+S + +E++R L Sbjct: 67 YVIKTTPVTFLLKDIAKIKSGAKDPKKQTVATISKEQALEIARYKL 112
>RL11_BORBU (O51354) 50S ribosomal protein L11| Length = 143 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 16 TYSIGIAPSNNLLQSLSRIQITENSKNRDTVATVSVGKKMEVSRIDLEN 162 ++ + P++ L++ I+ N D V T+S K ME++RI + + Sbjct: 69 SFIVKTPPASILIKKAIGIESGSKKSNTDKVGTISKEKLMEIARIKMSD 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,022,949 Number of Sequences: 219361 Number of extensions: 1047265 Number of successful extensions: 2265 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2265 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)