Clone Name | rbastl41e09 |
---|---|
Clone Library Name | barley_pub |
>SC6A3_RAT (P23977) Sodium-dependent dopamine transporter (DA transporter)| (DAT) Length = 619 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 107 LHLGESRSVEQFVPVTWWLAQLETTLIILVQVCLHGKIW 223 LHL +SR ++ P W L T ++LV V L+ +W Sbjct: 221 LHLHQSRGIDDLGPPRWQL----TACLVLVIVLLYFSLW 255
>SC6A3_MOUSE (Q61327) Sodium-dependent dopamine transporter (DA transporter)| (DAT) Length = 619 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 107 LHLGESRSVEQFVPVTWWLAQLETTLIILVQVCLHGKIW 223 LHL +SR ++ P W L T ++LV V L+ +W Sbjct: 221 LHLHQSRGIDDLGPPRWQL----TACLVLVIVLLYFSLW 255
>SC6A3_BOVIN (P27922) Sodium-dependent dopamine transporter (DA transporter)| (DAT) Length = 693 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 107 LHLGESRSVEQFVPVTWWLAQLETTLIILVQVCLHGKIW 223 LHL ES+ ++ P W L T+ ++LV V L+ +W Sbjct: 219 LHLHESQGIDDLGPPRWQL----TSCLVLVIVLLYFSLW 253
>FOXK1_MOUSE (P42128) Forkhead box protein K1 (Myocyte nuclear factor) (MNF)| Length = 617 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 154 MVAGTARNHTHHPRAGLSS 210 M G+ R H+HHP AG +S Sbjct: 576 MAPGSPRTHSHHPTAGYTS 594
>ZP3_RABIT (P48833) Zona pellucida sperm-binding protein 3 precursor (Zona| pellucida glycoprotein ZP3) (Sperm receptor) (Zona pellucida protein C) (Fragment) Length = 415 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 112 SGRIAICRAICSCNMVAGTARNHTHHPRAGLSSRENLARS*D 237 S I C C+++AG+ N H R+ L SR ++ D Sbjct: 309 SADICECCGNGDCDLIAGSPMNQNHAARSSLRSRRHVTEEAD 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,035,965 Number of Sequences: 219361 Number of extensions: 756722 Number of successful extensions: 1766 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1765 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)