Clone Name | rbastl41d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 28 | 8.8 |
---|
>ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 194 AANSYTNLVFRPSNKTVVQTIFSEYIEQYLSQ 289 A+N+ + ++ P +K ++ T+F+ YIE + Q Sbjct: 199 ASNNNWDYLYEPESKLILDTLFNRYIESQVYQ 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,607,064 Number of Sequences: 219361 Number of extensions: 897258 Number of successful extensions: 1534 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1532 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)