| Clone Name | rbastl41c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMJ8_CAEEL (P34483) Hypothetical protein F59B2.8 | 30 | 2.3 | 2 | VE2_HPV48 (Q80923) Regulatory protein E2 | 29 | 3.8 | 3 | RUMA_ACIAD (Q6F847) 23S rRNA (uracil-5-)-methyltransferase rumA ... | 28 | 6.6 | 4 | HIS82_ANAVT (Q3MAX6) Histidinol-phosphate aminotransferase 2 (EC... | 28 | 8.6 |
|---|
>YMJ8_CAEEL (P34483) Hypothetical protein F59B2.8| Length = 435 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +2 Query: 32 IKVCNQRMLQLLNDNWNSPRISVLNTHHYLRLGGREQQSRDIMFIGEKNNSY 187 I +C++RM Q + D I + HYL LG QQS I F E+ Y Sbjct: 33 ISLCSKRMAQTVRD------IHITADLHYLTLGKDNQQSIQIQFKQEQKVIY 78
>VE2_HPV48 (Q80923) Regulatory protein E2| Length = 396 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +2 Query: 89 RISVLNTHHYLRLGGREQQSRD---IMFIGEKNN--SYKTSCPADVAQQYI 226 R + L H Y RLG ++++RD ++F G++NN ++ C A ++ Sbjct: 293 RSTTLARHGYSRLGRLQEEARDPPLVLFTGQQNNLKCWRNRCTTKYASLFL 343
>RUMA_ACIAD (Q6F847) 23S rRNA (uracil-5-)-methyltransferase rumA (EC 2.1.1.-)| (23S rRNA(M-5-U1939)-methyltransferase) Length = 463 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = +2 Query: 206 DVAQQYIHH*QFYSTRMTRDLGFHLYTK----ILCC*PNRNNTFQIFSCLAD 349 + AQ +H+ +FYS +T+D H + L P R+ F+I +A+ Sbjct: 353 NAAQNALHNVEFYSQDLTKDFSHHSWANQGFDALLIDPPRSGAFEIMHYIAN 404
>HIS82_ANAVT (Q3MAX6) Histidinol-phosphate aminotransferase 2 (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase 2) Length = 380 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 56 LQLLNDNWNSPRISVLNTHHYLRLGG 133 LQL DN NSP ++LN H L+ G Sbjct: 321 LQLKTDNKNSPDTALLNLHQQLKNSG 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,114,654 Number of Sequences: 219361 Number of extensions: 1018039 Number of successful extensions: 2312 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2312 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)