Clone Name | rbastl41c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VEIN_DROME (Q94918) Protein vein precursor (Epidermal growth fac... | 29 | 2.9 | 2 | NU2C_MARPO (P06257) NAD(P)H-quinone oxidoreductase chain 2, chlo... | 28 | 6.4 | 3 | METE_AQUAE (O67606) 5-methyltetrahydropteroyltriglutamate--homoc... | 28 | 8.4 | 4 | BAI1_HUMAN (O14514) Brain-specific angiogenesis inhibitor 1 prec... | 28 | 8.4 |
---|
>VEIN_DROME (Q94918) Protein vein precursor (Epidermal growth factor-like| protein) (Protein defective dorsal discs) Length = 623 Score = 29.3 bits (64), Expect = 2.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 134 HMREWIISTNQNITPMKLQVILLWICLGTC 223 H+R+W + T + + P+ L +I + L TC Sbjct: 5 HLRKWSLKTKKQLMPLILLIISYMLLLNTC 34
>NU2C_MARPO (P06257) NAD(P)H-quinone oxidoreductase chain 2, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 2) (NADH-plastoquinone oxidoreductase chain 2) Length = 501 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 119 KWTVFLSEKSLYSYLITLFVLRFSYKDSIVVSF 21 K T++L SL S LI++ +L F YK ++SF Sbjct: 38 KDTIWLYFISLTSLLISIIILLFQYKTDPIISF 70
>METE_AQUAE (O67606) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 761 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +1 Query: 61 TNRVIKYEYKLFSERKTVHLIFVYPHAGMDNLYQPKYHTNEASGHLALDLPG 216 T ++ + EYK F ++K + I V G+D L ++ ++ + A+ L G Sbjct: 452 TGKISEEEYKNFIKQKIKYAIEVQEDIGLDVLVHGEFERSDMVEYFAIKLDG 503
>BAI1_HUMAN (O14514) Brain-specific angiogenesis inhibitor 1 precursor| Length = 1584 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 114 PFNLCIPTCGNG*SLPTKISHQ*SFRSSCSG 206 P+++C TCG G T+ S+ + CSG Sbjct: 362 PWSVCSSTCGEGWQTRTRFCVSSSYSTQCSG 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,561,270 Number of Sequences: 219361 Number of extensions: 642156 Number of successful extensions: 1046 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)