Clone Name | rbastl41b12 |
---|---|
Clone Library Name | barley_pub |
>SYD_PROMT (Q46I98) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 606 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 93 NKNRLERVHHRYCAKKP 143 ++NRLE +HH +CA KP Sbjct: 453 DENRLEAIHHPFCAPKP 469
>KCNH1_MOUSE (Q60603) Potassium voltage-gated channel subfamily H member 1| (Voltage-gated potassium channel subunit Kv10.1) (Ether-a-go-go potassium channel 1) (EAG1) (m-eag) Length = 989 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 157 PAQPVSSEQICCTTLADHQKPWKPRSICIG 246 PA PVS + +T++DH K P S C+G Sbjct: 794 PATPVSFQAATTSTMSDHAKLHAPGSECLG 823
>KCNH1_RAT (Q63472) Potassium voltage-gated channel subfamily H member 1| (Voltage-gated potassium channel subunit Kv10.1) (Ether-a-go-go potassium channel 1) (EAG1) (r-eag) Length = 962 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 157 PAQPVSSEQICCTTLADHQKPWKPRSICIG 246 PA PVS + +T++DH K P S C+G Sbjct: 767 PATPVSFQAASTSTVSDHAKLHAPGSECLG 796
>NMD2_SCHPO (O13824) Nonsense-mediated mRNA decay protein 2 (Up-frameshift| suppressor 2) Length = 1049 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 20 KHYYDIQMFL*RYIRE*TKFSLL 88 KH YD ++ + RYI E TKF L+ Sbjct: 533 KHEYDTRLLIVRYISELTKFQLM 555
>ARNT_ECOLI (P76473) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Polymyxin resistance protein pmrK) Length = 550 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -1 Query: 225 LPGLLVIGECSAAYLFT*YRLSWHEMPVVFWHSTYGGLS---LVYFC*LSKLNFVYSLMY 55 LPG L G + + T Y LSW MP++F+ G L L F L+ L Y+L+ Sbjct: 275 LPGALYTGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPTYILSCFASLAMLMAHYALLA 334 Query: 54 RYRN 43 N Sbjct: 335 AKNN 338
>ARNT_ECOL6 (Q8FFL9) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -1 Query: 225 LPGLLVIGECSAAYLFT*YRLSWHEMPVVFWHSTYGGLS---LVYFC*LSKLNFVYSLMY 55 LPG L G + + T Y LSW MP++F+ G L L F L+ L Y+L+ Sbjct: 275 LPGALYAGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPTYILSCFAPLAMLMAHYALLA 334 Query: 54 RYRN 43 N Sbjct: 335 AKNN 338
>ARNT_ECO57 (Q8XDZ1) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -1 Query: 225 LPGLLVIGECSAAYLFT*YRLSWHEMPVVFWHSTYGGLS---LVYFC*LSKLNFVYSLMY 55 LPG L G + + T Y LSW MP++F+ G L L F L+ L Y+L+ Sbjct: 275 LPGALYTGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPTYILSCFAPLAMLMAHYALLA 334 Query: 54 RYRN 43 N Sbjct: 335 AKNN 338
>ARNT_SHIFL (Q83KB6) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 28.1 bits (61), Expect = 5.9 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -1 Query: 225 LPGLLVIGECSAAYLFT*YRLSWHEMPVVFWHSTYGGLS---LVYFC*LSKLNFVYSLMY 55 LPG L G + + T Y LSW MP++F+ G L L F L+ L Y+L+ Sbjct: 275 LPGALYTGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPTYILSCFAPLAMLLAHYALLA 334 Query: 54 RYRN 43 N Sbjct: 335 AKNN 338 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,717,077 Number of Sequences: 219361 Number of extensions: 792644 Number of successful extensions: 1678 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1678 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)