Clone Name | rbastl41b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.6 | 2 | SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.6 | 3 | URED_SYNY3 (P73047) Urease accessory protein ureD | 28 | 7.9 |
---|
>SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 63 VLPLQRRNAVHKGHRP 110 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 63 VLPLQRRNAVHKGHRP 110 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 284 SVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 165 +V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 6 TVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,789,866 Number of Sequences: 219361 Number of extensions: 622455 Number of successful extensions: 1707 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1707 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)