Clone Name | rbastl41b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAL2_ORYSA (P53443) Phenylalanine ammonia-lyase (EC 4.3.1.5) | 29 | 5.0 | 2 | CCNA1_HUMAN (P78396) Cyclin-A1 | 29 | 5.0 | 3 | TTLL4_HUMAN (Q14679) Tubulin--tyrosine ligase-like protein 4 | 28 | 6.6 | 4 | SYM_ENTFA (Q837B3) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 28 | 6.6 |
---|
>PAL2_ORYSA (P53443) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 710 Score = 28.9 bits (63), Expect = 5.0 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +1 Query: 130 CVRIARGPLYTGPAALLKVQEKRNEKKHIIFNYRESLVAVARLALREIEVAGAA 291 CVR PL G A + +E K I YR+ LV + +LR +VA A Sbjct: 17 CVRPRADPLNWGKATEEMTGSQVDEVKRIGAEYRQPLVKIEGASLRIAQVAAVA 70
>CCNA1_HUMAN (P78396) Cyclin-A1| Length = 465 Score = 28.9 bits (63), Expect = 5.0 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -2 Query: 234 LAIIENDVFL-FVPFLLYFEQCCWASI*WSSCDSHTWPSDESYGTGFRLKAIASC 73 L+++E D FL ++P L+ C A+ + + H WP + TG+ L I C Sbjct: 371 LSLLEADPFLKYLPSLIAAAAFCLANY---TVNKHFWPETLAAFTGYSLSEIVPC 422
>TTLL4_HUMAN (Q14679) Tubulin--tyrosine ligase-like protein 4| Length = 1199 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 292 HSWPELYLGRLLP*PSAYDRQRLPRLETLANRSAPSQGS 408 HS P+L+ LL S+Y ++ +LE+ RS+PS+ S Sbjct: 106 HSLPDLFNSTLLYRRSSYRQKPYQQLESFCLRSSPSEKS 144
>SYM_ENTFA (Q837B3) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 669 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 160 TGPAALLKVQEKRNEKKHIIFNYRESLVAVARL 258 T P L K +EKRNE + ++ + ESL VA L Sbjct: 439 TAPWVLAKEEEKRNELESVMIHLAESLRIVAIL 471 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,582,277 Number of Sequences: 219361 Number of extensions: 1007144 Number of successful extensions: 2278 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2276 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)