Clone Name | rbastl41a06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsB... | 31 | 1.4 | 2 | CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1) | 29 | 3.9 | 3 | DNS2B_MOUSE (Q9QY48) Deoxyribonuclease-2-beta precursor (EC 3.1.... | 28 | 8.8 |
---|
>CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsBeta) (Fatty| acid beta-hydroxylase) Length = 417 Score = 30.8 bits (68), Expect = 1.4 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +1 Query: 109 LTAQVPHAVSSQESNFTLK---CYINNRTLALNKGKITMSTRAQNFICITTLEAS 264 + Q+PH S S LK +I NRT N +NFIC+T EA+ Sbjct: 1 MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKNFICMTGAEAA 55
>CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1)| Length = 272 Score = 29.3 bits (64), Expect = 3.9 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 8/82 (9%) Frame = -3 Query: 275 VEVIEASNVVMQMKFWALVDIVIFPLFSARVLLFM*HFKVKFD--------SWDDTA*GT 120 VE++ A NV+ Q++ IV LF ++ +F ++V+ S DDT Sbjct: 147 VEILVAENVLTQIENLKTYPIVRSRLFQGKLQIFGWIYEVESGEVLQISRTSSDDTGIDE 206 Query: 119 CAVRNPGHDIKELADHSWHPYT 54 C VR PG K + P T Sbjct: 207 CPVRLPGSQEKAILGRCVVPLT 228
>DNS2B_MOUSE (Q9QY48) Deoxyribonuclease-2-beta precursor (EC 3.1.22.1)| (Deoxyribonuclease II beta) (DNase II beta) (DNase2-like acid DNase) (DNase II-like acid DNase) (Endonuclease DLAD) Length = 354 Score = 28.1 bits (61), Expect = 8.8 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +3 Query: 246 HNIRGLNYLHLSLNSFFSDQI 308 H+ +GLN++H + +SF++D I Sbjct: 223 HSAQGLNFVHFAKSSFYTDDI 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,016,086 Number of Sequences: 219361 Number of extensions: 995894 Number of successful extensions: 1834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1834 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)