Clone Name | rbastl41a05 |
---|---|
Clone Library Name | barley_pub |
>SAHH_PSEAE (Q9I685) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 32.0 bits (71), Expect = 0.70 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 70 KWKHTEFSILPRMLMHRLHSYTQTGFGGITISTVPKRISLI*QQLDGIFQPST 228 K K +LP+ L + GFGG+ PK+ I ++G F+P T Sbjct: 414 KAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSVEGPFKPDT 466
>SYC1_STRAW (Q82GD0) Cysteinyl-tRNA synthetase 1 (EC 6.1.1.16) (Cysteine--tRNA| ligase 1) (CysRS 1) Length = 466 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +1 Query: 82 TEFSILPRMLMHRLHSYTQTGFGGITISTVPKRISLI*QQLDGIFQPS-----TKSDPKR 246 TE + R L+ R H+Y G + + P+ + L Q+LD + QPS K DP+ Sbjct: 120 TEMVEMMRTLIERGHAYEADGNVYFDVRSFPEYLQLSNQELDNLLQPSGEGETGKRDPRD 179 Query: 247 Y 249 + Sbjct: 180 F 180
>PROB_MANSM (Q65RE1) Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase)| (GK) Length = 361 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 261 AVISSAEILYSIADEVGLFTETHRRK**SLAVFIVNMFQKHQRSVVNSHMNT 416 A++ AE LY + D+ GLF R+ + + +VN H RS+ T Sbjct: 149 AILVQAEQLYLLTDQQGLFDSDPRKNPQAKLIPVVNEITDHIRSIAGGSGTT 200
>PHLC_PSEAE (P06200) Hemolytic phospholipase C precursor (EC 3.1.4.3) (PLC-H)| (Heat labile-hemolysin) (Phosphatidylcholine cholinephosphohydrolase) Length = 730 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +3 Query: 126 FIHTNGVRGYNDQHSSK--ENKPNMTAAGRYLSAFYKERSKKVSGRW 260 F H NGVRG+ND + K + KP +Y + Y +K S +W Sbjct: 68 FGHLNGVRGFNDPRALKRQDGKPVWYQNYKYEFSPYHWDTKVTSAQW 114
>RMS1_YEAST (Q12504) Putative transcription regulator RMS1| Length = 494 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 376 WNMFTMNTASDYHLRRCVSVNKPTSSAME*RISADEITAQR 254 W M +DY +++CVS+ KP+ R ++ A+R Sbjct: 402 WKRCIMKRLADYPIKKCVSIEKPSKGNSLTREELRDVMARR 442
>TFAE_ECOLI (P09153) Tail fiber assembly protein homolog from lambdoid prophage| e14 Length = 200 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 101 PVC*CIDCIHTHKRGSGV*RSAQF 172 P C C+D THK G + RSA F Sbjct: 45 PACSCLDAPGTHKAGYAICRSADF 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,823,307 Number of Sequences: 219361 Number of extensions: 1309262 Number of successful extensions: 2532 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2532 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)