Clone Name | rbastl41a04 |
---|---|
Clone Library Name | barley_pub |
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 334 NG*GHPRPSARPPPTTLRSAVP 399 +G GH RPS PPPTT+ + P Sbjct: 1215 SGPGHMRPSFEPPPTTIAAVPP 1236
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 334 NG*GHPRPSARPPPTTLRSAVP 399 +G GH RPS PPPTT+ + P Sbjct: 1223 SGPGHMRPSFEPPPTTIAAVPP 1244
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 334 NG*GHPRPSARPPPTTLRSAVP 399 +G GH RPS PPPTT+ + P Sbjct: 1216 SGPGHMRPSFEPPPTTIAAVPP 1237
>REF2P_DROME (P14199) Protein ref(2)P (Refractory to sigma P)| Length = 599 Score = 28.5 bits (62), Expect = 4.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 63 QCDTLDICKKCHIFYTHPTY 4 QC D+C+KC + + HP + Sbjct: 144 QCSNYDLCQKCELAHKHPEH 163
>RNG3_SCHPO (O74994) Ring assembly protein 3| Length = 746 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -1 Query: 345 TSTVTSNRRLHPLASRLVTTNAQKK*CLLL-RYPLLVHITQLRS 217 T SNR +HP++ L T +A + +LL ++ +L+ +T L S Sbjct: 523 TKAFPSNRAIHPMSKLLSTNSADTEYPILLGKFEVLLALTNLAS 566
>RL31_WIGBR (Q8D2S5) 50S ribosomal protein L31| Length = 71 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 51 LDICKKCHIFYT 16 LD+C KCH FYT Sbjct: 34 LDVCNKCHPFYT 45
>RL31_BUCAP (Q8K907) 50S ribosomal protein L31| Length = 72 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 51 LDICKKCHIFYT 16 LDIC KCH FYT Sbjct: 34 LDICAKCHPFYT 45
>RL31_BUCAI (P57639) 50S ribosomal protein L31| Length = 72 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 51 LDICKKCHIFYT 16 LDIC KCH FYT Sbjct: 34 LDICAKCHPFYT 45
>REF2P_DROSI (Q24629) Protein ref(2)P (Refractory to sigma P)| Length = 599 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 63 QCDTLDICKKCHIFYTHPTY 4 QC D+C+KC + HP + Sbjct: 144 QCSNFDLCQKCESAHKHPEH 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,169,347 Number of Sequences: 219361 Number of extensions: 853983 Number of successful extensions: 2308 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2308 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)