Clone Name | rbastl41a02 |
---|---|
Clone Library Name | barley_pub |
>LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cell antigen 2)| (SCA-2) Length = 126 Score = 30.4 bits (67), Expect = 1.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 402 LCFKCSSATSNFGANCCTISKCTILPSIVANHCTNEHHCLT 280 +CF CS A+SN+ C T KC NE HC+T Sbjct: 22 ICFSCSDASSNWA--CLTPVKC----------AENEEHCVT 50
>MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 transcription| factor) Length = 163 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 136 DKTVAIQKELCFHISQDTRLPPNDI 210 ++T+ I KEL ++QDTR PND+ Sbjct: 138 ERTLTISKELSDLLNQDTRCSPNDV 162
>CCSA_CYACA (O19901) Cytochrome c biogenesis protein ccsA| Length = 293 Score = 28.5 bits (62), Expect = 4.0 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 12/106 (11%) Frame = -1 Query: 403 SLLQVLISHKQLRSKLLYNKQVYYFAF--HC---GQSLYK*APLSNCTRTHHQKLVNLLQ 239 + L L+S +KL Y KQ+ F+ C + L C R + L NL + Sbjct: 16 AFLGALVSSLFYWAKLTYYKQIQVFSLPKFCLIFSNCIIAGMLLERCFRYSYFPLSNLYE 75 Query: 238 NLPSVSWAVKC-------HLAVVSCLAICENTILFGWQLFCLPSLL 122 +L +SW + L+++ + T++ G+ + LP L Sbjct: 76 SLLFLSWVLNIITIIFVDKLSIIGAIGSSAVTLIIGYANYILPPSL 121
>GR98B_DROME (Q9VB26) Putative gustatory receptor 98b| Length = 403 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/70 (25%), Positives = 30/70 (42%) Frame = -2 Query: 357 CCTISKCTILPSIVANHCTNEHHCLTARAHIIRNWSICFKIYPPFHGL*NVIWR*SRVLR 178 C T+ +LP +++ C N ++C H IR C P F L + S + Sbjct: 297 CSTLLVNLLLPCLLSQRCINAYNCFPRILHKIR----CTSADPNFAMLTRGLREYSLQME 352 Query: 177 YVKTQFFLDG 148 ++K +F G Sbjct: 353 HLKLRFTCGG 362
>PKHD1_HUMAN (Q8TCZ9) Polycystic kidney and hepatic disease 1 precursor| (Fibrocystin) (Polyductin) (Tigmin) Length = 4074 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 379 HKQLRSKLLYNKQVYYFAFHCGQSLYK*APLSNCTR 272 HK +LL++ V + + H G LYK + L NCTR Sbjct: 3109 HKCSSCELLWSDNVAHSSLH-GLHLYKESGLDNCTR 3143
>ITB5_MOUSE (O70309) Integrin beta-5 precursor| Length = 798 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 393 KCSSATSNFGANCCTI-SKCTILPSIVANHCTNEHHCLTARAHIIRNWSICFK 238 KC+ + + N +I S+C + +++ N C E + H++RN + K Sbjct: 45 KCAWCSKEYFGNPRSITSRCDLKANLIRNGCEGEIESPASSTHVLRNLPLSSK 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,442,802 Number of Sequences: 219361 Number of extensions: 979727 Number of successful extensions: 2080 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2080 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)