Clone Name | rbastl40h09 |
---|---|
Clone Library Name | barley_pub |
>PSME2_MOUSE (P97372) Proteasome activator complex subunit 2 (Proteasome| activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta) Length = 238 Score = 30.4 bits (67), Expect = 2.0 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +2 Query: 35 TDIKQTTETSQAGYLTLHNKIFHQHA---SKTWQVMISCQHIISWIQHL 172 TD ++ E + GYL + K+ A + W + C +I+WIQHL Sbjct: 79 TDKQEKKEVPKCGYLPGNEKLLALLALVKPEVWTLKEKCILVITWIQHL 127
>SNAA1_ARATH (Q9LXZ5) Alpha-soluble NSF attachment protein 1 (Alpha-SNAP1)| (N-ethylmaleimide-sensitive factor attachment protein, alpha 1) Length = 381 Score = 30.0 bits (66), Expect = 2.7 Identities = 24/75 (32%), Positives = 39/75 (52%) Frame = +1 Query: 37 RYKTDHRNQSSRIFNITQQDISSTCFQNLASHDKLSAHYFLDPASNTIDRLISPERRTVT 216 RY+T + SSR FN++QQ S CF+ H+ AH + I L ++RT+T Sbjct: 22 RYQTTRVSNSSRDFNLSQQHCS--CFRPKRRHE---AHL------SFIGTLQYSKQRTIT 70 Query: 217 NNNTASYSDRHGVIL 261 +A+ + R ++L Sbjct: 71 RAASATIARRQLLLL 85
>PSME2_HUMAN (Q9UL46) Proteasome activator complex subunit 2 (Proteasome| activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta) Length = 238 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +2 Query: 35 TDIKQTTETSQAGYLTLHNKIFHQHA---SKTWQVMISCQHIISWIQHL 172 TD ++ E + G+L + K+ A + W + C +I+WIQHL Sbjct: 79 TDKQEKKEVPKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHL 127
>PSME2_BOVIN (Q5E9G3) Proteasome activator complex subunit 2 (Proteasome| activator 28-beta subunit) (PA28beta) (PA28b) Length = 238 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +2 Query: 35 TDIKQTTETSQAGYLTLHNKIFHQHA---SKTWQVMISCQHIISWIQHL 172 TD ++ E + G+L + K+ A + W + C +I+WIQHL Sbjct: 79 TDKQEKKEVPKCGFLPGNEKVLALLALVKPEVWTLKEKCILVITWIQHL 127
>YGB5_YEAST (P33199) Hypothetical 15.0 kDa protein in PDR6-PDR1 intergenic| region Length = 130 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 94 DISSTCFQNLASHDKLSAHYFLDPASNTI 180 D+ S CF N D LS + FL P S+ + Sbjct: 72 DVDSLCFSNCFQPDALSGNVFLPPRSSNM 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,191,730 Number of Sequences: 219361 Number of extensions: 1274571 Number of successful extensions: 3313 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3313 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)