Clone Name | rbastl40h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FSHR_FELCA (Q5GJ04) Follicle-stimulating hormone receptor precur... | 28 | 4.8 | 2 | PAFA_CAEEL (Q22943) Platelet-activating factor acetylhydrolase h... | 28 | 8.2 |
---|
>FSHR_FELCA (Q5GJ04) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 695 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -2 Query: 229 LSLSHVMSLF*YMNYNLAPCGILLICCCDSHL-LPVSKPHLVAGCLESKI 83 LS +VMSL L ++ICCC +H+ L V P++V+ ++KI Sbjct: 526 LSQLYVMSLL-----VLNVLAFVVICCCYAHIYLTVRNPNIVSSSSDTKI 570
>PAFA_CAEEL (Q22943) Platelet-activating factor acetylhydrolase homolog 2 (EC| 3.1.1.47) Length = 388 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 82 QFLTPNTQQPNVVSTLAVGDYRSSR*AKSHMAQDCSSYTRIKTLHGKG 225 ++L ++Q+ NV+++ VG+ R + M+ C + + HG G Sbjct: 71 EYLGQSSQKMNVITSTVVGEKREDCIENAQMSTKCDKWPIVVFSHGLG 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,773,709 Number of Sequences: 219361 Number of extensions: 709471 Number of successful extensions: 1222 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1222 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)