Clone Name | rbastl40h06 |
---|---|
Clone Library Name | barley_pub |
>ATU2_YEAST (P38995) Copper-transporting ATPase (EC 3.6.3.4) (Cu(2+)-ATPase)| Length = 1004 Score = 32.3 bits (72), Expect = 0.48 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 48 ERNRSQLTTCYNLQGTIE-RTVTHHDDTRTWQTTILMSTSLQVTLILLHPA*PFLW 212 ER + T NL T + R ++ D+ R W+ + ST L + +LL+ P +W Sbjct: 224 ERTGYKFTVFSNLDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMW 279
>RPTN_MOUSE (P97347) Repetin| Length = 1130 Score = 28.9 bits (63), Expect = 5.3 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +3 Query: 228 TSDSKCTQSEIQGSTGTGQR*AGLSTDELETDEAQQHGCQSSSPAAKQSR 377 + S C QSEI + GQ L TD D +H +S + + SR Sbjct: 854 SQSSHCGQSEIGKTENQGQNRHSLGTDRTRRDSYVEHSGRSGKLSQQNSR 903
>MYPC3_HUMAN (Q14896) Myosin-binding protein C, cardiac-type (Cardiac MyBP-C)| (C-protein, cardiac muscle isoform) Length = 1274 Score = 28.9 bits (63), Expect = 5.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 378 LWIASQPEKMTDSRVVVPHLFQVHQLT 298 +W+ + E + DSR+ V H+ +VH+LT Sbjct: 576 VWLKNGKELVPDSRIKVSHIGRVHKLT 602
>TNAP3_MOUSE (Q60769) Tumor necrosis factor, alpha-induced protein 3 (EC| 3.-.-.-) (Putative DNA binding protein A20) (Zinc finger protein A20) Length = 775 Score = 28.1 bits (61), Expect = 9.0 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Frame = -2 Query: 209 QKGLSWV*QY*R--NL*TSGH*NCCLPCSCIIVMGNRSFDCTL*VVACCELRSVP---FI 45 QK L+W + + L T+G NC + +C + G + D L C L+ F Sbjct: 80 QKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFK 139 Query: 44 FTWEFNATRSITF 6 F W+ + +S F Sbjct: 140 FRWQLESLKSQEF 152
>ZBTB5_MOUSE (Q7TQG0) Zinc finger and BTB domain-containing protein 5| (Transcription factor ZNF-POZ) Length = 670 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 134 CSCIIVMGNRSFDCTL*VVACC 69 C C+IV+GNR F V+A C Sbjct: 24 CDCVIVVGNRHFKAHRSVLAAC 45
>ZBTB5_HUMAN (O15062) Zinc finger and BTB domain-containing protein 5| Length = 677 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 134 CSCIIVMGNRSFDCTL*VVACC 69 C C+IV+GNR F V+A C Sbjct: 24 CDCVIVVGNRHFKAHRSVLAAC 45
>YGI8_YEAST (P53151) Hypothetical 14.2 kDa protein in MFAL2-MAD1 intergenic| region Length = 121 Score = 28.1 bits (61), Expect = 9.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 193 GCNSISVTCRLVDIRI 146 GCNS+SV C L D+R+ Sbjct: 100 GCNSLSVVCFLADLRV 115
>PBF_MAIZE (O24463) Dof zinc finger protein PBF (Prolamin box-binding factor)| Length = 328 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 217 TNEVLQIQSVPNQRFKALQEQGNDKQACQLMNLKQMRHNN 336 TN+ Q+ P Q KA+ + N+ L+NL +HNN Sbjct: 273 TNDARQLVG-PQQDNKAIMKSSNNNNGVSLLNLYWNKHNN 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,991,703 Number of Sequences: 219361 Number of extensions: 968233 Number of successful extensions: 2143 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2142 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)