Clone Name | rbastl40g09 |
---|---|
Clone Library Name | barley_pub |
>EBNA3_EBV (P12977) Epstein-Barr nuclear antigen 3 (EBV nuclear antigen 3)| (EBNA-3) (EBNA-3A) Length = 812 Score = 32.0 bits (71), Expect = 0.61 Identities = 30/83 (36%), Positives = 38/83 (45%), Gaps = 11/83 (13%) Frame = +1 Query: 193 GRWVP--WTGQGEPPSRGACPVRAGCQSLGAS*GNLQIQNHPRNLSLPHIPA*MMAMHL- 363 G WVP W QG PPS+G V+ +LG + L NHP +P PA + HL Sbjct: 648 GPWVPEQWMFQGAPPSQGTDVVQHQLDALGYT---LHGLNHP---GVPVSPA-VNQYHLS 700 Query: 364 -GAFG-------TWRGSGRRDPC 408 AFG + GS +PC Sbjct: 701 QAAFGLPIDEDESGEGSDTSEPC 723
>RNAS1_MYOGL (Q9WUS1) Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1)| (RNase A) Length = 156 Score = 31.6 bits (70), Expect = 0.80 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 258 CAYRTCTTGWRFALACPRDPSAPVSIDST 172 CAYRT R +AC DPS PV D + Sbjct: 123 CAYRTTQKVKRIVVACEGDPSVPVHYDGS 151
>ZEP2_HUMAN (P31629) Human immunodeficiency virus type I enhancer-binding protein| 2 (HIV-EP2) (MHC-binding protein 2) (MBP-2) Length = 2446 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 310 DDFG-FEDYLNLPQDSDSLRVPDMHHGMEVRLGLSKGPICP 191 D+FG ++L +P S SL VP HH E+R S+ CP Sbjct: 998 DEFGKHSEFLTVPAGSYSLSVPGHHHQKEMRRCSSEQMPCP 1038
>RNAS2_AOTTR (O18937) Nonsecretory ribonuclease precursor (EC 3.1.27.5)| (Ribonuclease US) (Eosinophil-derived neurotoxin) (RNase UpI-2) (Ribonuclease 2) (RNase 2) Length = 158 Score = 30.4 bits (67), Expect = 1.8 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 8/70 (11%) Frame = -2 Query: 357 HCHHLCWDMRQ*QVPWMILDLKITLTCPKTLTACAYRTCTTGWRFALAC--------PRD 202 +CHH + QVP +L T P T+T C Y + + +AC P+ Sbjct: 97 NCHH-----SRVQVPLTYCNL----TGPPTITNCVYSSTQANMFYVVACDNRDQRDPPQY 147 Query: 201 PSAPVSIDST 172 P PV +D+T Sbjct: 148 PVVPVHLDTT 157
>RNAS2_SAGOE (P47786) Nonsecretory ribonuclease precursor (EC 3.1.27.5)| (Ribonuclease US) (Eosinophil-derived neurotoxin) (RNase UpI-2) (Ribonuclease 2) (RNase 2) Length = 158 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 8/46 (17%) Frame = -2 Query: 285 LTCPKTLTACAYRTCTTGWRFALAC----PRDPS----APVSIDST 172 LT P+T++ C Y + + +AC PRDP PV +D+T Sbjct: 112 LTGPQTISNCVYSSTQANMFYVVACDNRDPRDPPQYPVVPVHLDTT 157
>KPB2_HUMAN (P46019) Phosphorylase b kinase alpha regulatory chain, liver isoform| (Phosphorylase kinase alpha L subunit) Length = 1235 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 417 STSARISTPRSSPGSKGPQVHCHHLCWDMRQ*Q 319 S SAR STP S G+ HH+ W RQ Q Sbjct: 1034 SKSARSSTPSSPTGTSSSDSGGHHIGWGERQGQ 1066
>RNAS4_MOUSE (Q9JJH1) Ribonuclease 4 precursor (EC 3.1.27.-) (RNase 4)| Length = 148 Score = 28.9 bits (63), Expect = 5.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 258 CAYRTCTTGWRFALACPRDPSAPVSID 178 C YR T+ R +AC DP PV D Sbjct: 121 CRYRARTSTRRVVIACEGDPEVPVHFD 147
>SYD_LACPL (Q88VQ8) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 598 Score = 28.9 bits (63), Expect = 5.2 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = -1 Query: 397 DAQILSRFQRPPGALPSSMLGYEAMTGSLDDFGFEDYLNLPQDSDSLRVPDMHHGMEVRL 218 DA+IL++ + PP + DD D L L LR P+M G+++R Sbjct: 100 DAKILNKAKTPPFYIQ-------------DDINVSDELRLKYRYLDLRRPEMQRGLKIRN 146 Query: 217 GLSK 206 G+++ Sbjct: 147 GITQ 150
>ZEP2_RAT (Q00900) Human immunodeficiency virus type I enhancer-binding protein| 2 homolog (DNA-binding protein AGIE-BP1) (Angiotensinogen gene-inducible enhancer-binding protein 1) (Myc intron-binding protein 1) Length = 2437 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 292 DYLNLPQDSDSLRVPDMHHGMEVRLGLSKGPICP 191 ++L +P S SL VP HH E+R S+ CP Sbjct: 1002 EFLTVPAGSYSLSVPGHHHQKEMRRCSSEQMPCP 1035
>KPB2_RABIT (P46018) Phosphorylase b kinase alpha regulatory chain, liver isoform| (Phosphorylase kinase alpha L subunit) Length = 1235 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 417 STSARISTPRSSPGSKGPQVHCHHLCWDMRQ*Q 319 S S R STP S G+ HH+ W RQ Q Sbjct: 1034 SKSVRSSTPSSPTGTSSSDSGGHHISWGERQGQ 1066
>CLCN1_MOUSE (Q64347) Chloride channel protein, skeletal muscle (Chloride| channel protein 1) (ClC-1) Length = 994 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 146 TTYHKTNTWVESIETGADGSLGQAKANLHPVVHV 247 +T NTWV+ I G SLGQ+ LHP V+V Sbjct: 425 STLFDNNTWVKHI--GDPQSLGQSAVWLHPQVNV 456
>ZEP2_MOUSE (Q3UHF7) Human immunodeficiency virus type I enhancer-binding protein| 2 homolog (Myc intron-binding protein 1) (MIBP-1) Length = 2430 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 292 DYLNLPQDSDSLRVPDMHHGMEVRLGLSKGPICP 191 ++L +P S SL VP HH E+R S+ CP Sbjct: 997 EFLTVPAGSYSLSVPGHHHQKEMRRCSSEQMPCP 1030
>MTFA_PSEPK (Q88L23) Putative RNA 2'-O-ribose methyltransferase mtfA (EC| 2.1.1.-) Length = 354 Score = 28.5 bits (62), Expect = 6.7 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +2 Query: 110 RPSDWYRCWTGSTTYHKTN---TWVESIETGADGSLGQAKANLHPVVHVRYAQAVRVLGQ 280 +P DW C T+ TW+ +G +A NL + RYA+ R+L + Sbjct: 263 QPVDWMVCDIVEKPARTTSLIETWL------GEGLCREAVVNLKLPMKQRYAEVRRLLDR 316 Query: 281 VKVIFKSKIIQGTCHC 328 ++ FK++ I+ + C Sbjct: 317 MEATFKARKIRVSIAC 332
>RNAS1_PONPY (Q8SQ12) Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1)| (RNase A) Length = 156 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 258 CAYRTCTTGWRFALACPRDPSAPVSIDST 172 CAYRT T +AC P PV D++ Sbjct: 123 CAYRTSTKERHIIVACEGSPYVPVHFDAS 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,241,487 Number of Sequences: 219361 Number of extensions: 1449664 Number of successful extensions: 4016 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4016 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)