Clone Name | rbastl40g03 |
---|---|
Clone Library Name | barley_pub |
>NUP98_RAT (P49793) Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98| kDa nucleoporin) Length = 937 Score = 37.4 bits (85), Expect = 0.015 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 379 YKEMLVKKAEEQGVEFISFDAAKGEWKFKVKHFSSYGFAEAE 254 Y+ L + +QG +F + G W FKV HFS YG +++ Sbjct: 847 YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSD 888
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 37.4 bits (85), Expect = 0.015 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 379 YKEMLVKKAEEQGVEFISFDAAKGEWKFKVKHFSSYGFAEAE 254 Y+ L + +QG +F + G W FKV HFS YG +++ Sbjct: 848 YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSD 889
>NU189_SCHPO (Q9UTK4) Nucleoporin nup189 (Nuclear pore protein nup189)| Length = 1778 Score = 35.8 bits (81), Expect = 0.042 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = -2 Query: 418 TSEPYTEGPRVDKYKEMLVKKAEEQGVEFISFDAAKGEWKFKVKHFSSYGFAEAE 254 T EP + P+ +Y + + + + EFI F+ G+W FKV+HFS YG + E Sbjct: 892 TREPIKD-PQNPRYIQHVKRLHRIKDTEFIDFN--DGKWIFKVQHFSRYGLLDDE 943
>NU145_YEAST (P49687) Nucleoporin NUP145 precursor (EC 3.4.21.-) (Nuclear pore| protein NUP145) [Contains: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)] Length = 1317 Score = 34.3 bits (77), Expect = 0.12 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -2 Query: 418 TSEPYTEGPRVDKYKEMLVKKAEEQGVEFISFDAAKGEWKFKVKHFSSYGFAEAEVGLID 239 T +P + + +++ K + + +IS++ G W FKV HFS +G E ID Sbjct: 560 TKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEID 619
>CP312_DROME (Q9VVN6) Probable cytochrome P450 312a1 (EC 1.14.-.-) (CYPCCCXIIA1)| Length = 510 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 36 RQSIHLYNPHTHTHSTKLAQGCALHKQERSVQNIETKDKPHSIIQKT 176 R++ + N H H H KL G L+ + + ++I+ ++QKT Sbjct: 59 RRATEMINEHLHDHRAKLWMGTKLYLVDCNPKDIQALCSAQQLLQKT 105
>NARZ_ECOLI (P19319) Respiratory nitrate reductase 2 alpha chain (EC 1.7.99.4)| Length = 1245 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 69 HTHSTKLAQGCALHKQERSVQNIETKDKPHSIIQKTKASQ*ESSEISYN 215 HTH ALHK++ ++ + + +P II S ES +SYN Sbjct: 981 HTH-------LALHKEDEKIRFRDIQAQPRKIISSPTWSGLESDHVSYN 1022
>STAB2_RAT (Q8CFM6) Stabilin-2 precursor (Hyaluronan receptor for endocytosis)| [Contains: 175 kDa stabilin-2 (175 kDa hyaluronan receptor for endocytosis)] (Fragment) Length = 1431 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 145 KISHIALFRKQKRHNESPPKSVTTSMDGATWNRSGL 252 +IS R Q+RH +SPP + + +++ W + L Sbjct: 1376 RISQTLCMRPQRRHPQSPPVTPSQTLENRIWRTATL 1411
>MAAY3_SCHCO (P37934) Mating-type protein A-alpha Y3| Length = 926 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 120 RSVQNIETKD--KPHSIIQKTKASQ*ESSEISYNFHGRGYMESIRPTSAS 263 ++ Q++E +D K H +KTKA + ++ + GR + +S + TS++ Sbjct: 325 KNAQDVEMRDATKSHEKRRKTKAMPRPAGQVPMDVDGRAHKKSTKTTSSA 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,021,635 Number of Sequences: 219361 Number of extensions: 887774 Number of successful extensions: 2504 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2502 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)