Clone Name | rbastl40f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7) | 31 | 0.74 | 2 | CUT9_SCHPO (P41889) 20S cyclosome/APC complex protein cut9 (Cell... | 28 | 8.2 |
---|
>CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 401 Score = 31.2 bits (69), Expect = 0.74 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 96 QLSTGNEILMSSIELHYILVPTLTLAHRHRQHFRVPRLSMLG 221 +L G+EI +S++E H L+P LAHR H V L G Sbjct: 106 RLEAGDEIAISALEHHANLLPWQQLAHRRNLHLVVLPLDAHG 147
>CUT9_SCHPO (P41889) 20S cyclosome/APC complex protein cut9 (Cell untimely torn| protein 9) Length = 671 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 42 YRIIKIYEIGTEKTHPAVQLSTGNEILMSSIELHYI--LVPTLTLAHRH 182 YR +K+Y+ + + + LST + + ++I L Y+ +P L + H H Sbjct: 526 YRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLH 574 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,665,044 Number of Sequences: 219361 Number of extensions: 541560 Number of successful extensions: 1280 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1280 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)