Clone Name | rbastl40f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YAT5_SCHPO (Q10151) Hypothetical protein C1D4.05c in chromosome I | 28 | 5.5 |
---|
>YAT5_SCHPO (Q10151) Hypothetical protein C1D4.05c in chromosome I| Length = 387 Score = 28.5 bits (62), Expect = 5.5 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 17/55 (30%) Frame = -3 Query: 115 SFFLP-----PFVVPVLCCLEY------------IMSELYLYTMTPTIYIRQLLH 2 +FF+P PF+V +L CL Y ++S L T P IY+ ++H Sbjct: 218 TFFVPLAMAYPFIVAILQCLHYGLSRRKHTFKINLLSALKHATALPVIYLSAIIH 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,105,299 Number of Sequences: 219361 Number of extensions: 192063 Number of successful extensions: 492 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 80,573,946 effective HSP length: 14 effective length of database: 77,502,892 effective search space used: 1860069408 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)