Clone Name | rbastl40f09 |
---|---|
Clone Library Name | barley_pub |
>MMT1_HORVU (Q9MBC2) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) (Hv-MMT1) Length = 1088 Score = 31.2 bits (69), Expect = 0.99 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 146 LAVFPSDDVFISQVLGLFSPGSGILDERM 60 + VFPS V I L LFSPG I+DE + Sbjct: 455 VVVFPSRAVAIENALRLFSPGLAIVDEHL 483
>FPPS_HUMAN (P14324) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 30.0 bits (66), Expect = 2.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K G+GL + +L + Sbjct: 112 RRGQICWYQKPGVGLDAINDANLLEA 137
>FPPS_CHICK (P08836) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 367 Score = 30.0 bits (66), Expect = 2.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K G+GL + +L S Sbjct: 126 RRGQLCWYKKEGVGLDAINDSFLLES 151
>MMT1_MAIZE (Q8W519) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) Length = 1091 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 146 LAVFPSDDVFISQVLGLFSPGSGILDERM 60 + VFPS V I L LFSP I+DE + Sbjct: 457 VVVFPSRSVAIENALQLFSPALAIVDEHL 485
>FPPS_NEUCR (Q92250) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 407 IFRRGHCCWWNKTGIGLAELTSGGMLNS 324 I RRG CW+ + G+G+ + ML S Sbjct: 102 ITRRGKPCWYRQEGVGMVAINDAFMLES 129
>FPPS_GIBFU (Q92235) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 407 IFRRGHCCWWNKTGIGLAELTSGGMLNS 324 I RRG CW+ + G+G+ + ML S Sbjct: 102 ITRRGQPCWYRQEGVGMIAINDAFMLES 129
>FPPS_RAT (P05369) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K GIGL + +L + Sbjct: 112 RRGQICWYQKPGIGLDAINDALLLEA 137
>FPPS_MOUSE (Q920E5) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 401 RRGHCCWWNKTGIGLAELTSGGMLNS 324 RRG CW+ K GIGL + +L + Sbjct: 112 RRGQICWYQKPGIGLDAINDALLLEA 137
>SYP1_YEAST (P25623) Suppressor of yeast profilin deletion| Length = 870 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +2 Query: 218 IHAQSRIKIQSTTA*QNNVTHQTNTRDVPN*HPTRVSSTCPRKLAPQGRSPSYSTNSN 391 I +++ K + +N Q + + PN TRVSST + + R P+YS++ + Sbjct: 348 IFGRNKTKNKRQQQSSSNSHIQASITETPNNSSTRVSSTATSSIYQKQRRPTYSSSKS 405
>SPRI_DROME (Q8MQW8) Protein sprint (SH2 poly-proline-containing Ras-interactor| protein) Length = 1790 Score = 28.5 bits (62), Expect = 6.4 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 78 TTTRRKQP*HLRNKHII*RKNSQQMRRRRLHSHFFST 188 TTT R+Q H N H N QQM+ R+LH+H + + Sbjct: 55 TTTNRQQQHH--NHH-----NQQQMQSRQLHAHHWQS 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,497,222 Number of Sequences: 219361 Number of extensions: 1111022 Number of successful extensions: 2510 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2510 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)