| Clone Name | rbastl40f04 |
|---|---|
| Clone Library Name | barley_pub |
>ROBO3_MOUSE (Q9Z2I4) Roundabout homolog 3 precursor (Retinoblastoma-inhibiting| gene 1) (Rig-1) Length = 1366 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/55 (29%), Positives = 19/55 (34%) Frame = +1 Query: 154 WKEDGKNLSQQAGRARRISGQEASAPPASGRGVG*RICRGPRSRTPAFSRCNWSS 318 W E+ S G G + GRG G CR P S C WS+ Sbjct: 1300 WGEESGAGSASRGPTSSQRGPHPDGKESQGRGRGLEACRSPNSPQLPLDSCIWST 1354
>CRF_CANFA (P49926) Corticoliberin precursor (Corticotropin-releasing factor)| (CRF) (Corticotropin-releasing hormone) Length = 196 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -2 Query: 365 LPPHVKRRPLPASRTVLLQL---HLLNAGVLDLGPLQILHPTPLPLAGGA 225 LPP ++ P +R VL ++ + L G L+ P L P P+AGG+ Sbjct: 49 LPPQPQQPQQPQARPVLYRMGEEYFLRLGNLNKSPAAPLLPASSPVAGGS 98
>CWC22_DEBHA (Q6BU84) Pre-mRNA-splicing factor CWC22| Length = 637 Score = 28.5 bits (62), Expect = 4.2 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +1 Query: 169 KNLS-QQAGRARRISGQEASAPPASGRGVG*RICRGPRSRTPAFSRCNWSSTVRLAGRGR 345 KNL ++ GR+R +SG S + R G SR+ + SR S R RGR Sbjct: 537 KNLPPEERGRSRSVSGSSRSGSSSYSRSRSYSRSSGSYSRSRSRSRSRSRSRSRTGSRGR 596 Query: 346 LLT 354 ++ Sbjct: 597 TMS 599
>SMBP2_HUMAN (P38935) DNA-binding protein SMUBP-2 (EC 3.6.1.-) (ATP-dependent| helicase IGHMBP2) (Immunoglobulin mu-binding protein 2) (SMUBP-2) (Glial factor 1) (GF-1) Length = 993 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 142 SSQAWKEDGKNLSQQAGRARRISGQEASAPPASGR 246 S A K G S + G R+ GQEA+AP GR Sbjct: 660 SHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGR 694
>PYY_HUMAN (P10082) Peptide YY precursor (PYY) (PYY-I) (Peptide tyrosine| tyrosine) [Contains: Peptide YY(3-36) (PYY-II)] Length = 97 Score = 28.1 bits (61), Expect = 5.5 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = -2 Query: 347 RRPLPASRTVLLQLHLLNAGVLDLGPLQILHPTPLPLAGGAEASWPEMRR 198 RRP PA TVLL L + ++D P++ P A G +AS E+ R Sbjct: 5 RRPWPALTTVLLALLVCLGALVDAYPIK-------PEAPGEDASPEELNR 47
>PO23_POPJA (Q05118) Retrovirus-related Pol polyprotein from type-1| retrotransposable element R2 (Retrovirus-related Pol polyprotein from type I retrotransposable element R2) [Includes: Reverse transcriptase (EC 2.7.7.49); Endonuclease] (Fragment) Length = 606 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 242 PLAGGAEASWPEMRRALPACWLRFLPSSFQAWELHTQLK 126 PL GA WP R +P C + +P++ +A +HT LK Sbjct: 543 PLLLGARGIWP--RANVPTCNILSIPTTLRASCVHTCLK 579
>GLUB7_ORYSA (Q52PJ1) Glutelin type-B 7 precursor [Contains: Glutelin type-B 7| acidic chain; Glutelin type-B 7 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 131 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 238 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483
>GLUB2_ORYSA (Q02897) Glutelin type-B 2 precursor [Contains: Glutelin type-B 2| acidic chain; Glutelin type-B 2 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 131 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 238 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483
>GNEFR_HUMAN (Q9UGK8) Guanine nucleotide exchange factor-related protein| (Deafness locus associated putative guanine nucleotide exchange factor) (DelGEF) Length = 458 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 304 CNWSSTVRLAGRGRLLTCGGRS 369 C W T+ L G++L+CG S Sbjct: 108 CGWDFTIMLTENGQVLSCGSNS 129
>DHCR7_BOVIN (Q5E9J5) 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC| reductase) (Sterol delta-7-reductase) Length = 475 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 171 KSQPAG--RKSTAHFRPGSFSASSQWKRSW 254 KSQP+ KST+ G+ +A QW R+W Sbjct: 4 KSQPSAPKTKSTSGLTNGNAAAQGQWGRAW 33
>GNEFR_MOUSE (Q80YD6) Guanine nucleotide exchange factor-related protein| (Deafness locus associated putative guanine nucleotide exchange factor) (DelGEF) Length = 464 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 262 ICRGPRSRTPAFSRCNWSSTVRLAGRGRLLTCGGRS 369 IC+ R C W T+ L +G++L+CG + Sbjct: 94 ICKPLRGCPIRQVACGWDFTIMLTEKGQVLSCGSNA 129
>DAPD_BORPE (P0A4U8) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate| N-succinyltransferase (EC 2.3.1.117) (Tetrahydrodipicolinate N-succinyltransferase) (THP succinyltransferase) (Tetrahydropicolinate succinylase) Length = 273 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 326 RTVLLQLHLLNAGVLDLGPLQILHPTPLPLAGGAEASW 213 + VLL L + V+ GPLQ P AG EA++ Sbjct: 62 KAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAF 99
>DAPD_BORPA (Q7W8Y2) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate| N-succinyltransferase (EC 2.3.1.117) (Tetrahydrodipicolinate N-succinyltransferase) (THP succinyltransferase) (Tetrahydropicolinate succinylase) Length = 273 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 326 RTVLLQLHLLNAGVLDLGPLQILHPTPLPLAGGAEASW 213 + VLL L + V+ GPLQ P AG EA++ Sbjct: 62 KAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAF 99
>DAPD_BORBR (P0A4U9) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate| N-succinyltransferase (EC 2.3.1.117) (Tetrahydrodipicolinate N-succinyltransferase) (THP succinyltransferase) (Tetrahydropicolinate succinylase) Length = 273 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 326 RTVLLQLHLLNAGVLDLGPLQILHPTPLPLAGGAEASW 213 + VLL L + V+ GPLQ P AG EA++ Sbjct: 62 KAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAF 99
>RM12_CRICR (P52827) 39S ribosomal protein L12, mitochondrial precursor (L12mt)| (MRP-L12) (P2A1) Length = 203 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 143 APRLGRRTAKISASRQEEHGAFQARKL 223 APRLG R A++ +RQ+ G AR+L Sbjct: 13 APRLGLRGARLRLARQQVPGVCAARQL 39
>GDF15_HUMAN (Q99988) Growth/differentiation factor 15 precursor (GDF-15)| (Placental bone morphogenic protein) (Placental TGF-beta) (Macrophage inhibitory cytokine 1) (MIC-1) (Prostate differentiation factor) (NSAID-regulated protein 1) (NRG-1) Length = 308 Score = 27.3 bits (59), Expect = 9.3 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 1/85 (1%) Frame = -2 Query: 311 QLHLLNAGVLDLGPLQ-ILHPTPLPLAGGAEASWPEMRRALPACWLRFLPSSFQAWELHT 135 +LH + A + DLG +L P + ++ + AC PS F+A +H Sbjct: 212 RLHTVRASLEDLGWADWVLSPREV-----------QVTMCIGAC-----PSQFRAANMHA 255 Query: 134 QLKVCHWYLEARLLEFACCAPKFSN 60 Q+K L+ + CC P N Sbjct: 256 QIKTSLHRLKPDTVPAPCCVPASYN 280
>AOC2_HUMAN (O75106) Retina-specific copper amine oxidase precursor (EC| 1.4.3.6) (RAO) (Amine oxidase [copper-containing]) Length = 756 Score = 27.3 bits (59), Expect = 9.3 Identities = 20/84 (23%), Positives = 29/84 (34%) Frame = -2 Query: 356 HVKRRPLPASRTVLLQLHLLNAGVLDLGPLQILHPTPLPLAGGAEASWPEMRRALPACWL 177 H+K LP + L N L +H TP L G A+W + + L Sbjct: 178 HLKEVELPKAPIFLSSTFNYNGSTL-----AAVHATPRGLRSGDRATWMALYHNISGVGL 232 Query: 176 RFLPSSFQAWELHTQLKVCHWYLE 105 P + H L HW ++ Sbjct: 233 FLHPVGLELLLDHRALDPAHWTVQ 256
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 272 PLQI----LHPTPLPLAGGAEASWPEMRRALPAC 183 PLQI LHP P P+A P + RA P C Sbjct: 374 PLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVC 407
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 272 PLQI----LHPTPLPLAGGAEASWPEMRRALPAC 183 PLQI LHP P P+A P + RA P C Sbjct: 374 PLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVC 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,755,025 Number of Sequences: 219361 Number of extensions: 1126678 Number of successful extensions: 3228 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 3161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3228 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)